BLASTX nr result
ID: Sinomenium22_contig00016376
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00016376 (1242 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK23205.1| unknown [Picea sitchensis] 105 5e-20 ref|XP_006849451.1| hypothetical protein AMTR_s00024p00072990 [A... 102 3e-19 ref|XP_007037017.1| Acyl-CoA N-acyltransferases superfamily prot... 97 2e-17 ref|XP_007209479.1| hypothetical protein PRUPE_ppa010100mg [Prun... 94 9e-17 ref|XP_004299499.1| PREDICTED: N-alpha-acetyltransferase 40-like... 93 3e-16 ref|XP_006466359.1| PREDICTED: N-alpha-acetyltransferase 40-like... 92 4e-16 ref|XP_007037015.1| Acyl-CoA N-acyltransferases superfamily prot... 92 4e-16 ref|XP_007037014.1| Acyl-CoA N-acyltransferases superfamily prot... 92 4e-16 ref|XP_002263749.2| PREDICTED: N-alpha-acetyltransferase 40-like... 92 5e-16 ref|XP_002452897.1| hypothetical protein SORBIDRAFT_04g034570 [S... 92 6e-16 ref|XP_002318313.2| GCN5-related N-acetyltransferase family prot... 91 8e-16 ref|XP_007037018.1| Acyl-CoA N-acyltransferases superfamily prot... 91 8e-16 ref|XP_007037016.1| Acyl-CoA N-acyltransferases superfamily prot... 91 8e-16 ref|XP_006426211.1| hypothetical protein CICLE_v10026363mg [Citr... 91 1e-15 ref|XP_007037011.1| Acyl-CoA N-acyltransferases superfamily prot... 91 1e-15 gb|AFW73670.1| hypothetical protein ZEAMMB73_468552 [Zea mays] 90 2e-15 gb|AFW73669.1| N-acetyltransferase [Zea mays] 90 2e-15 ref|NP_001149697.1| LOC100283323 [Zea mays] gi|195629560|gb|ACG3... 90 2e-15 gb|EYU21859.1| hypothetical protein MIMGU_mgv1a012595mg [Mimulus... 89 3e-15 ref|XP_004954070.1| PREDICTED: N-alpha-acetyltransferase 40-like... 89 4e-15 >gb|ABK23205.1| unknown [Picea sitchensis] Length = 272 Score = 105 bits (261), Expect = 5e-20 Identities = 50/63 (79%), Positives = 57/63 (90%) Frame = +2 Query: 23 NHMSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKA 202 NHM AVMLTVQK N+ AM+FY +KLRY+IS+ISPS+VDPL+GAEKSYEILCKTFD EAK Sbjct: 202 NHMKAVMLTVQKRNISAMNFYTSKLRYIISSISPSRVDPLIGAEKSYEILCKTFDSEAKT 261 Query: 203 KLE 211 KLE Sbjct: 262 KLE 264 >ref|XP_006849451.1| hypothetical protein AMTR_s00024p00072990 [Amborella trichopoda] gi|548853026|gb|ERN11032.1| hypothetical protein AMTR_s00024p00072990 [Amborella trichopoda] Length = 257 Score = 102 bits (254), Expect = 3e-19 Identities = 50/64 (78%), Positives = 55/64 (85%) Frame = +2 Query: 23 NHMSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKA 202 N M AVMLTVQK NL AM+FY NK+R+ IS+ SPS VDPL+GAEKSYEILCKTFD EAKA Sbjct: 174 NQMGAVMLTVQKSNLSAMNFYRNKMRFSISSTSPSSVDPLMGAEKSYEILCKTFDEEAKA 233 Query: 203 KLEV 214 KLEV Sbjct: 234 KLEV 237 >ref|XP_007037017.1| Acyl-CoA N-acyltransferases superfamily protein isoform 7, partial [Theobroma cacao] gi|508774262|gb|EOY21518.1| Acyl-CoA N-acyltransferases superfamily protein isoform 7, partial [Theobroma cacao] Length = 259 Score = 96.7 bits (239), Expect = 2e-17 Identities = 47/66 (71%), Positives = 57/66 (86%) Frame = +2 Query: 23 NHMSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKA 202 NHM A++LTVQK N AM FYM+KLR++IS+ISPS+V+PLVG E +YEILCKTFD +AKA Sbjct: 175 NHMGALVLTVQKANSLAMKFYMSKLRFVISSISPSRVNPLVGVENNYEILCKTFDPDAKA 234 Query: 203 KLEVYS 220 LEVYS Sbjct: 235 ILEVYS 240 >ref|XP_007209479.1| hypothetical protein PRUPE_ppa010100mg [Prunus persica] gi|462405214|gb|EMJ10678.1| hypothetical protein PRUPE_ppa010100mg [Prunus persica] Length = 264 Score = 94.4 bits (233), Expect = 9e-17 Identities = 45/63 (71%), Positives = 54/63 (85%) Frame = +2 Query: 23 NHMSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKA 202 NHM AV+LTVQK N A++FY+ K+RY+ STISPS+VDPL+G EKSYEILCKTF +EAKA Sbjct: 193 NHMGAVVLTVQKANSAALNFYLCKMRYVTSTISPSRVDPLIGVEKSYEILCKTFSNEAKA 252 Query: 203 KLE 211 LE Sbjct: 253 ILE 255 >ref|XP_004299499.1| PREDICTED: N-alpha-acetyltransferase 40-like [Fragaria vesca subsp. vesca] Length = 259 Score = 92.8 bits (229), Expect = 3e-16 Identities = 44/63 (69%), Positives = 56/63 (88%) Frame = +2 Query: 23 NHMSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKA 202 NHM+AV+LTVQK NL AM+FY +K+RY+IS+ISPSKVDP +G +KSYEILCK+F ++AKA Sbjct: 195 NHMTAVVLTVQKANLVAMNFYTSKMRYVISSISPSKVDPWLGTQKSYEILCKSFSNDAKA 254 Query: 203 KLE 211 LE Sbjct: 255 ILE 257 >ref|XP_006466359.1| PREDICTED: N-alpha-acetyltransferase 40-like [Citrus sinensis] Length = 243 Score = 92.4 bits (228), Expect = 4e-16 Identities = 43/63 (68%), Positives = 54/63 (85%) Frame = +2 Query: 23 NHMSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKA 202 N M AV+LTVQK NL AM+FY++KLRY++S+ISPS+VDP G EKSYEILCK FD+E+KA Sbjct: 180 NRMGAVVLTVQKANLLAMNFYLSKLRYVVSSISPSRVDPFTGVEKSYEILCKVFDNESKA 239 Query: 203 KLE 211 L+ Sbjct: 240 LLQ 242 >ref|XP_007037015.1| Acyl-CoA N-acyltransferases superfamily protein isoform 5 [Theobroma cacao] gi|508774260|gb|EOY21516.1| Acyl-CoA N-acyltransferases superfamily protein isoform 5 [Theobroma cacao] Length = 244 Score = 92.4 bits (228), Expect = 4e-16 Identities = 45/64 (70%), Positives = 55/64 (85%) Frame = +2 Query: 23 NHMSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKA 202 NHM A++LTVQK N AM FYM+KLR++IS+ISPS+V+PLVG E +YEILCKTFD +AKA Sbjct: 175 NHMGALVLTVQKANSLAMKFYMSKLRFVISSISPSRVNPLVGVENNYEILCKTFDPDAKA 234 Query: 203 KLEV 214 LEV Sbjct: 235 ILEV 238 >ref|XP_007037014.1| Acyl-CoA N-acyltransferases superfamily protein isoform 4 [Theobroma cacao] gi|508774259|gb|EOY21515.1| Acyl-CoA N-acyltransferases superfamily protein isoform 4 [Theobroma cacao] Length = 242 Score = 92.4 bits (228), Expect = 4e-16 Identities = 45/64 (70%), Positives = 55/64 (85%) Frame = +2 Query: 23 NHMSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKA 202 NHM A++LTVQK N AM FYM+KLR++IS+ISPS+V+PLVG E +YEILCKTFD +AKA Sbjct: 175 NHMGALVLTVQKANSLAMKFYMSKLRFVISSISPSRVNPLVGVENNYEILCKTFDPDAKA 234 Query: 203 KLEV 214 LEV Sbjct: 235 ILEV 238 >ref|XP_002263749.2| PREDICTED: N-alpha-acetyltransferase 40-like [Vitis vinifera] gi|296088809|emb|CBI38259.3| unnamed protein product [Vitis vinifera] Length = 309 Score = 92.0 bits (227), Expect = 5e-16 Identities = 45/69 (65%), Positives = 54/69 (78%) Frame = +2 Query: 23 NHMSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKA 202 N M AV+LTVQK N AM+FY+ KLRY I++ISPS+V+PL+G + SYEILCK F EAKA Sbjct: 204 NSMGAVVLTVQKANFSAMNFYVGKLRYTIASISPSRVNPLIGVDSSYEILCKAFSDEAKA 263 Query: 203 KLEVYSSLL 229 KLEV S L Sbjct: 264 KLEVTSDAL 272 >ref|XP_002452897.1| hypothetical protein SORBIDRAFT_04g034570 [Sorghum bicolor] gi|241932728|gb|EES05873.1| hypothetical protein SORBIDRAFT_04g034570 [Sorghum bicolor] Length = 174 Score = 91.7 bits (226), Expect = 6e-16 Identities = 47/63 (74%), Positives = 52/63 (82%) Frame = +2 Query: 23 NHMSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKA 202 N M AVMLTVQK N AMDFY KLRY+IS+ SPS+VDP +G EKSYEILCKTFD EAK+ Sbjct: 109 NQMGAVMLTVQKANTLAMDFY-TKLRYVISSTSPSRVDPQIGLEKSYEILCKTFDSEAKS 167 Query: 203 KLE 211 KLE Sbjct: 168 KLE 170 >ref|XP_002318313.2| GCN5-related N-acetyltransferase family protein [Populus trichocarpa] gi|550326328|gb|EEE96533.2| GCN5-related N-acetyltransferase family protein [Populus trichocarpa] Length = 267 Score = 91.3 bits (225), Expect = 8e-16 Identities = 45/61 (73%), Positives = 51/61 (83%) Frame = +2 Query: 29 MSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKAKL 208 M AV+LTVQK N AM+FY +KLRY IS+ISPS+VDPL+G EKSYEILCK FDHEAK L Sbjct: 204 MGAVVLTVQKANAVAMNFYRSKLRYTISSISPSRVDPLMGLEKSYEILCKAFDHEAKVIL 263 Query: 209 E 211 E Sbjct: 264 E 264 >ref|XP_007037018.1| Acyl-CoA N-acyltransferases superfamily protein isoform 8 [Theobroma cacao] gi|508774263|gb|EOY21519.1| Acyl-CoA N-acyltransferases superfamily protein isoform 8 [Theobroma cacao] Length = 187 Score = 91.3 bits (225), Expect = 8e-16 Identities = 44/64 (68%), Positives = 55/64 (85%) Frame = +2 Query: 23 NHMSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKA 202 NHM A++LTVQK N AM FYM+KLR++IS+ISPS+V+PLVG E +YEILCKTFD +AKA Sbjct: 108 NHMGALVLTVQKANSLAMKFYMSKLRFVISSISPSRVNPLVGVENNYEILCKTFDPDAKA 167 Query: 203 KLEV 214 LE+ Sbjct: 168 ILEL 171 >ref|XP_007037016.1| Acyl-CoA N-acyltransferases superfamily protein isoform 6 [Theobroma cacao] gi|508774261|gb|EOY21517.1| Acyl-CoA N-acyltransferases superfamily protein isoform 6 [Theobroma cacao] Length = 254 Score = 91.3 bits (225), Expect = 8e-16 Identities = 44/64 (68%), Positives = 55/64 (85%) Frame = +2 Query: 23 NHMSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKA 202 NHM A++LTVQK N AM FYM+KLR++IS+ISPS+V+PLVG E +YEILCKTFD +AKA Sbjct: 175 NHMGALVLTVQKANSLAMKFYMSKLRFVISSISPSRVNPLVGVENNYEILCKTFDPDAKA 234 Query: 203 KLEV 214 LE+ Sbjct: 235 ILEL 238 >ref|XP_006426211.1| hypothetical protein CICLE_v10026363mg [Citrus clementina] gi|557528201|gb|ESR39451.1| hypothetical protein CICLE_v10026363mg [Citrus clementina] Length = 243 Score = 90.9 bits (224), Expect = 1e-15 Identities = 42/63 (66%), Positives = 54/63 (85%) Frame = +2 Query: 23 NHMSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKA 202 N M AV+LTVQK NL AM+FY++KLRY++S+ISPS+VDP G EKSYEILCK FD+++KA Sbjct: 180 NRMGAVVLTVQKANLLAMNFYLSKLRYVVSSISPSRVDPFTGVEKSYEILCKVFDNKSKA 239 Query: 203 KLE 211 L+ Sbjct: 240 LLQ 242 >ref|XP_007037011.1| Acyl-CoA N-acyltransferases superfamily protein isoform 1 [Theobroma cacao] gi|590666581|ref|XP_007037012.1| Acyl-CoA N-acyltransferases superfamily protein isoform 1 [Theobroma cacao] gi|590666585|ref|XP_007037013.1| Acyl-CoA N-acyltransferases superfamily protein isoform 1 [Theobroma cacao] gi|508774256|gb|EOY21512.1| Acyl-CoA N-acyltransferases superfamily protein isoform 1 [Theobroma cacao] gi|508774257|gb|EOY21513.1| Acyl-CoA N-acyltransferases superfamily protein isoform 1 [Theobroma cacao] gi|508774258|gb|EOY21514.1| Acyl-CoA N-acyltransferases superfamily protein isoform 1 [Theobroma cacao] Length = 240 Score = 90.9 bits (224), Expect = 1e-15 Identities = 44/63 (69%), Positives = 54/63 (85%) Frame = +2 Query: 23 NHMSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKA 202 NHM A++LTVQK N AM FYM+KLR++IS+ISPS+V+PLVG E +YEILCKTFD +AKA Sbjct: 175 NHMGALVLTVQKANSLAMKFYMSKLRFVISSISPSRVNPLVGVENNYEILCKTFDPDAKA 234 Query: 203 KLE 211 LE Sbjct: 235 ILE 237 >gb|AFW73670.1| hypothetical protein ZEAMMB73_468552 [Zea mays] Length = 218 Score = 89.7 bits (221), Expect = 2e-15 Identities = 46/63 (73%), Positives = 51/63 (80%) Frame = +2 Query: 23 NHMSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKA 202 N M AVMLTVQK N AM FY KLRY+IS+ SPS+VDP +G EKSYEILCKTFD EAK+ Sbjct: 153 NQMGAVMLTVQKANTQAMAFY-TKLRYVISSTSPSRVDPQIGLEKSYEILCKTFDSEAKS 211 Query: 203 KLE 211 KLE Sbjct: 212 KLE 214 >gb|AFW73669.1| N-acetyltransferase [Zea mays] Length = 285 Score = 89.7 bits (221), Expect = 2e-15 Identities = 46/63 (73%), Positives = 51/63 (80%) Frame = +2 Query: 23 NHMSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKA 202 N M AVMLTVQK N AM FY KLRY+IS+ SPS+VDP +G EKSYEILCKTFD EAK+ Sbjct: 220 NQMGAVMLTVQKANTQAMAFY-TKLRYVISSTSPSRVDPQIGLEKSYEILCKTFDSEAKS 278 Query: 203 KLE 211 KLE Sbjct: 279 KLE 281 >ref|NP_001149697.1| LOC100283323 [Zea mays] gi|195629560|gb|ACG36421.1| N-acetyltransferase [Zea mays] gi|413939120|gb|AFW73671.1| N-acetyltransferase [Zea mays] Length = 256 Score = 89.7 bits (221), Expect = 2e-15 Identities = 46/63 (73%), Positives = 51/63 (80%) Frame = +2 Query: 23 NHMSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKA 202 N M AVMLTVQK N AM FY KLRY+IS+ SPS+VDP +G EKSYEILCKTFD EAK+ Sbjct: 191 NQMGAVMLTVQKANTQAMAFY-TKLRYVISSTSPSRVDPQIGLEKSYEILCKTFDSEAKS 249 Query: 203 KLE 211 KLE Sbjct: 250 KLE 252 >gb|EYU21859.1| hypothetical protein MIMGU_mgv1a012595mg [Mimulus guttatus] Length = 245 Score = 89.4 bits (220), Expect = 3e-15 Identities = 44/62 (70%), Positives = 52/62 (83%) Frame = +2 Query: 29 MSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKAKL 208 M AV+LTVQ+ N AMDFY++KLRY IS ISPS+VDPL+G EKSYEILCKTFD +A+A Sbjct: 183 MGAVVLTVQRANRLAMDFYISKLRYTISAISPSRVDPLLGPEKSYEILCKTFDPDAQAVF 242 Query: 209 EV 214 EV Sbjct: 243 EV 244 >ref|XP_004954070.1| PREDICTED: N-alpha-acetyltransferase 40-like isoform X2 [Setaria italica] Length = 252 Score = 89.0 bits (219), Expect = 4e-15 Identities = 46/63 (73%), Positives = 51/63 (80%) Frame = +2 Query: 23 NHMSAVMLTVQKDNLHAMDFYMNKLRYMISTISPSKVDPLVGAEKSYEILCKTFDHEAKA 202 N M AVMLTVQK N AM FY KLRY+IS+ SPS+VDP +G EKSYEILCKTFD EAK+ Sbjct: 185 NQMGAVMLTVQKANTQAMAFY-TKLRYVISSTSPSRVDPQIGLEKSYEILCKTFDCEAKS 243 Query: 203 KLE 211 KLE Sbjct: 244 KLE 246