BLASTX nr result
ID: Sinomenium22_contig00016369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00016369 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267857.1| PREDICTED: uncharacterized protein LOC100247... 58 2e-06 ref|XP_007163707.1| hypothetical protein PHAVU_001G257500g [Phas... 56 5e-06 >ref|XP_002267857.1| PREDICTED: uncharacterized protein LOC100247607 [Vitis vinifera] gi|297738317|emb|CBI27518.3| unnamed protein product [Vitis vinifera] Length = 466 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -3 Query: 331 GWDYSPRLSSVRGADDPFHQEHPLKSSSQRSDIHDTHTQ 215 GW+YSPRLS V G DDPFH+EHP KSS+ HDT+TQ Sbjct: 428 GWNYSPRLSCVHGEDDPFHEEHPSKSSA-----HDTNTQ 461 >ref|XP_007163707.1| hypothetical protein PHAVU_001G257500g [Phaseolus vulgaris] gi|561037171|gb|ESW35701.1| hypothetical protein PHAVU_001G257500g [Phaseolus vulgaris] Length = 464 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -3 Query: 331 GWDYSPRLSSVRGADDPFHQEHPLKSSSQRSDIHD 227 GW++SPRLSSV GADDPFHQ+H LKSS SD D Sbjct: 429 GWNFSPRLSSVHGADDPFHQDHLLKSSGCSSDTTD 463