BLASTX nr result
ID: Sinomenium22_contig00016297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00016297 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006419240.1| hypothetical protein CICLE_v10005631mg [Citr... 58 1e-06 ref|XP_006419239.1| hypothetical protein CICLE_v10005631mg [Citr... 58 1e-06 gb|AFK37816.1| unknown [Medicago truncatula] 56 4e-06 ref|XP_003609873.1| Putative plant SNARE [Medicago truncatula] g... 56 4e-06 ref|XP_007035980.1| Plant SNARE 13 isoform 2 [Theobroma cacao] g... 56 6e-06 ref|XP_007035979.1| Plant snare 13 isoform 1 [Theobroma cacao] g... 56 6e-06 ref|XP_002519319.1| novel plant snare, putative [Ricinus communi... 56 6e-06 ref|XP_002267688.1| PREDICTED: novel plant SNARE 13 [Vitis vinif... 55 8e-06 >ref|XP_006419240.1| hypothetical protein CICLE_v10005631mg [Citrus clementina] gi|557521113|gb|ESR32480.1| hypothetical protein CICLE_v10005631mg [Citrus clementina] Length = 262 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 IVNPNNKDIRDIPGLAPPAPSRRLLSLSA 89 +VNPNNKDIRDIPGLAPPAP+RRLLSL A Sbjct: 230 VVNPNNKDIRDIPGLAPPAPARRLLSLQA 258 >ref|XP_006419239.1| hypothetical protein CICLE_v10005631mg [Citrus clementina] gi|567852155|ref|XP_006419241.1| hypothetical protein CICLE_v10005631mg [Citrus clementina] gi|568871114|ref|XP_006488738.1| PREDICTED: novel plant SNARE 13-like isoform X1 [Citrus sinensis] gi|568871116|ref|XP_006488739.1| PREDICTED: novel plant SNARE 13-like isoform X2 [Citrus sinensis] gi|557521112|gb|ESR32479.1| hypothetical protein CICLE_v10005631mg [Citrus clementina] gi|557521114|gb|ESR32481.1| hypothetical protein CICLE_v10005631mg [Citrus clementina] Length = 268 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 IVNPNNKDIRDIPGLAPPAPSRRLLSLSA 89 +VNPNNKDIRDIPGLAPPAP+RRLLSL A Sbjct: 236 VVNPNNKDIRDIPGLAPPAPARRLLSLQA 264 >gb|AFK37816.1| unknown [Medicago truncatula] Length = 269 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 3 IVNPNNKDIRDIPGLAPPAPSRRLLSLSATKLLD 104 IVNPNNKDIRDIPGLAPP PSRRLL + +L D Sbjct: 236 IVNPNNKDIRDIPGLAPPVPSRRLLYVRTGELFD 269 >ref|XP_003609873.1| Putative plant SNARE [Medicago truncatula] gi|355510928|gb|AES92070.1| Putative plant SNARE [Medicago truncatula] Length = 269 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 3 IVNPNNKDIRDIPGLAPPAPSRRLLSLSATKLLD 104 IVNPNNKDIRDIPGLAPP PSRRLL + +L D Sbjct: 236 IVNPNNKDIRDIPGLAPPVPSRRLLYVRTGELFD 269 >ref|XP_007035980.1| Plant SNARE 13 isoform 2 [Theobroma cacao] gi|508715009|gb|EOY06906.1| Plant SNARE 13 isoform 2 [Theobroma cacao] Length = 204 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +3 Query: 3 IVNPNNKDIRDIPGLAPPAPSRRLLSLSATKLLD 104 IVNP+NKDIRDIPGLAPPAPSRRLL L ++ L+ Sbjct: 171 IVNPSNKDIRDIPGLAPPAPSRRLLYLRESQYLE 204 >ref|XP_007035979.1| Plant snare 13 isoform 1 [Theobroma cacao] gi|508715008|gb|EOY06905.1| Plant snare 13 isoform 1 [Theobroma cacao] Length = 270 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +3 Query: 3 IVNPNNKDIRDIPGLAPPAPSRRLLSLSATKLLD 104 IVNP+NKDIRDIPGLAPPAPSRRLL L ++ L+ Sbjct: 237 IVNPSNKDIRDIPGLAPPAPSRRLLYLRESQYLE 270 >ref|XP_002519319.1| novel plant snare, putative [Ricinus communis] gi|223541634|gb|EEF43183.1| novel plant snare, putative [Ricinus communis] Length = 269 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 3 IVNPNNKDIRDIPGLAPPAPSRRLLSL 83 IVNPNNKDIRDIPGLAPPAPSRRLL L Sbjct: 236 IVNPNNKDIRDIPGLAPPAPSRRLLYL 262 >ref|XP_002267688.1| PREDICTED: novel plant SNARE 13 [Vitis vinifera] gi|297736807|emb|CBI26008.3| unnamed protein product [Vitis vinifera] Length = 269 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 3 IVNPNNKDIRDIPGLAPPAPSRRLLSLSATKLLD 104 IVNPNNK I+D+PGLAPPAPSRRLL L A+ L+ Sbjct: 236 IVNPNNKSIKDVPGLAPPAPSRRLLYLKASDYLE 269