BLASTX nr result
ID: Sinomenium22_contig00016211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00016211 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002875388.1| predicted protein [Arabidopsis lyrata subsp.... 65 7e-09 ref|XP_006291066.1| hypothetical protein CARUB_v10017182mg [Caps... 64 2e-08 ref|XP_003618758.1| Uridine kinase-like protein [Medicago trunca... 64 3e-08 ref|XP_006395440.1| hypothetical protein EUTSA_v10005624mg [Eutr... 63 4e-08 ref|NP_189380.1| uridine kinase-like 5 [Arabidopsis thaliana] gi... 63 4e-08 ref|XP_006446645.1| hypothetical protein CICLE_v10015113mg [Citr... 60 2e-07 ref|XP_002271589.2| PREDICTED: uridine kinase-like protein 5 [Vi... 60 2e-07 ref|XP_001783571.1| predicted protein [Physcomitrella patens] gi... 60 2e-07 ref|XP_004489614.1| PREDICTED: uridine kinase-like protein 5-lik... 60 3e-07 ref|XP_002509535.1| Uracil phosphoribosyltransferase, putative [... 60 3e-07 ref|XP_001785584.1| predicted protein [Physcomitrella patens] gi... 60 3e-07 ref|XP_006857687.1| hypothetical protein AMTR_s00061p00164140 [A... 60 4e-07 ref|XP_002323801.2| uracil phosphoribosyltransferase family prot... 59 5e-07 ref|XP_001755689.1| predicted protein [Physcomitrella patens] gi... 59 5e-07 ref|XP_001766266.1| predicted protein [Physcomitrella patens] gi... 59 5e-07 gb|EYU45398.1| hypothetical protein MIMGU_mgv1a005489mg [Mimulus... 59 7e-07 ref|XP_006470209.1| PREDICTED: uridine kinase-like protein 5-lik... 59 7e-07 ref|XP_006357203.1| PREDICTED: uridine kinase-like protein 5-lik... 59 7e-07 ref|XP_006848434.1| hypothetical protein AMTR_s00013p00237060 [A... 59 7e-07 ref|XP_007031841.1| Uridine kinase/uracil phosphoribosyltransfer... 59 7e-07 >ref|XP_002875388.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297321226|gb|EFH51647.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 464 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 KFP L++VTSEIDA+L+++SRVIPGMGEFADRYFGT Sbjct: 412 KFPMLKIVTSEIDASLNEDSRVIPGMGEFADRYFGT 447 >ref|XP_006291066.1| hypothetical protein CARUB_v10017182mg [Capsella rubella] gi|482559773|gb|EOA23964.1| hypothetical protein CARUB_v10017182mg [Capsella rubella] Length = 467 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 KFP ++LVTSEIDA+L+ +SRVIPGMGEFADRYFGT Sbjct: 414 KFPMVKLVTSEIDASLNADSRVIPGMGEFADRYFGT 449 >ref|XP_003618758.1| Uridine kinase-like protein [Medicago truncatula] gi|355493773|gb|AES74976.1| Uridine kinase-like protein [Medicago truncatula] Length = 970 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 KFP L+LVTSEIDATL++ SRVIPGMGEF+DRYF T Sbjct: 933 KFPMLKLVTSEIDATLNENSRVIPGMGEFSDRYFAT 968 >ref|XP_006395440.1| hypothetical protein EUTSA_v10005624mg [Eutrema salsugineum] gi|557092079|gb|ESQ32726.1| hypothetical protein EUTSA_v10005624mg [Eutrema salsugineum] Length = 465 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/36 (75%), Positives = 35/36 (97%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 K+P +++VTSEIDA+L+++SRVIPGMGEFADRYFGT Sbjct: 412 KYPMVKIVTSEIDASLNEDSRVIPGMGEFADRYFGT 447 >ref|NP_189380.1| uridine kinase-like 5 [Arabidopsis thaliana] gi|75311569|sp|Q9LTY6.1|UKL5_ARATH RecName: Full=Uridine kinase-like protein 5; Includes: RecName: Full=Probable uridine kinase; Short=UK; Includes: RecName: Full=Probable uracil phosphoribosyltransferase; Short=UPRTase; AltName: Full=UMP pyrophosphorylase gi|7939517|dbj|BAA95720.1| uridine kinase-like protein [Arabidopsis thaliana] gi|332643800|gb|AEE77321.1| uridine kinase-like 5 [Arabidopsis thaliana] Length = 465 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/36 (75%), Positives = 35/36 (97%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 KFP L++VTSEID++L+++SRVIPG+GEFADRYFGT Sbjct: 412 KFPMLKIVTSEIDSSLNEDSRVIPGLGEFADRYFGT 447 >ref|XP_006446645.1| hypothetical protein CICLE_v10015113mg [Citrus clementina] gi|557549256|gb|ESR59885.1| hypothetical protein CICLE_v10015113mg [Citrus clementina] Length = 473 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 +FP +++VTSEID+T+D+ +RVIPGMGEF DRYFGT Sbjct: 415 RFPKIKIVTSEIDSTIDEHARVIPGMGEFGDRYFGT 450 >ref|XP_002271589.2| PREDICTED: uridine kinase-like protein 5 [Vitis vinifera] gi|296087584|emb|CBI34840.3| unnamed protein product [Vitis vinifera] Length = 448 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 KFP L++VTSEID +L+K+ RVIPGMGEF DRYFGT Sbjct: 412 KFPTLKIVTSEIDMSLNKDLRVIPGMGEFGDRYFGT 447 >ref|XP_001783571.1| predicted protein [Physcomitrella patens] gi|162664900|gb|EDQ51603.1| predicted protein [Physcomitrella patens] Length = 437 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 KFP L++VTSEIDA L+ E RV+PGMGEF DRYFGT Sbjct: 369 KFPLLKIVTSEIDAGLNDEFRVVPGMGEFGDRYFGT 404 >ref|XP_004489614.1| PREDICTED: uridine kinase-like protein 5-like [Cicer arietinum] Length = 456 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 +FP L+LVTSEIDA+L+++SRVIPG+GEF DRYF T Sbjct: 419 RFPMLKLVTSEIDASLNEDSRVIPGLGEFGDRYFAT 454 >ref|XP_002509535.1| Uracil phosphoribosyltransferase, putative [Ricinus communis] gi|223549434|gb|EEF50922.1| Uracil phosphoribosyltransferase, putative [Ricinus communis] Length = 481 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 KFP L++VTSEID L++E RVIPGMGEF DRYFGT Sbjct: 444 KFPSLKIVTSEIDVALNEEFRVIPGMGEFGDRYFGT 479 >ref|XP_001785584.1| predicted protein [Physcomitrella patens] gi|162662785|gb|EDQ49596.1| predicted protein [Physcomitrella patens] Length = 520 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 +FP L++VTSEIDA L++E RV+PGMGEF DRYFGT Sbjct: 441 RFPLLKIVTSEIDAGLNEEYRVVPGMGEFGDRYFGT 476 >ref|XP_006857687.1| hypothetical protein AMTR_s00061p00164140 [Amborella trichopoda] gi|548861783|gb|ERN19154.1| hypothetical protein AMTR_s00061p00164140 [Amborella trichopoda] Length = 479 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT*E 114 KFP L++VTSEID L++E RVIPGMGEF DRYFGT E Sbjct: 433 KFPRLKIVTSEIDVDLNEEYRVIPGMGEFGDRYFGTDE 470 >ref|XP_002323801.2| uracil phosphoribosyltransferase family protein [Populus trichocarpa] gi|550319993|gb|EEF03934.2| uracil phosphoribosyltransferase family protein [Populus trichocarpa] Length = 454 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 KFP L++VTSEID TLD++ VIPGMGEF DRYFGT Sbjct: 417 KFPKLKIVTSEIDVTLDEDLCVIPGMGEFGDRYFGT 452 >ref|XP_001755689.1| predicted protein [Physcomitrella patens] gi|162693008|gb|EDQ79362.1| predicted protein [Physcomitrella patens] Length = 473 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 +FP L++VTSEIDA L+ E RV+PGMGEF DRYFGT Sbjct: 414 RFPLLKIVTSEIDAGLNDEFRVVPGMGEFGDRYFGT 449 >ref|XP_001766266.1| predicted protein [Physcomitrella patens] gi|162682480|gb|EDQ68898.1| predicted protein [Physcomitrella patens] Length = 445 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 KFP L++VT+EIDA L+ E RV+PGMGEF DRYFGT Sbjct: 377 KFPLLKIVTTEIDAGLNDEFRVVPGMGEFGDRYFGT 412 >gb|EYU45398.1| hypothetical protein MIMGU_mgv1a005489mg [Mimulus guttatus] Length = 482 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 +FP L++VTSEID L++E RVIPGMGEF DRYFGT Sbjct: 445 RFPSLKIVTSEIDVALNEEFRVIPGMGEFGDRYFGT 480 >ref|XP_006470209.1| PREDICTED: uridine kinase-like protein 5-like [Citrus sinensis] Length = 473 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 +FP +++VTSEID+++D+ +RVIPGMGEF DRYFGT Sbjct: 415 RFPKIKIVTSEIDSSIDEHARVIPGMGEFGDRYFGT 450 >ref|XP_006357203.1| PREDICTED: uridine kinase-like protein 5-like [Solanum tuberosum] Length = 454 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 K+P L++VTSEID TL+K+ VIPGMGEF DRYFGT Sbjct: 402 KYPRLKIVTSEIDTTLNKDLHVIPGMGEFGDRYFGT 437 >ref|XP_006848434.1| hypothetical protein AMTR_s00013p00237060 [Amborella trichopoda] gi|548851740|gb|ERN10015.1| hypothetical protein AMTR_s00013p00237060 [Amborella trichopoda] Length = 480 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 +FP L++VTSEID L++E RVIPGMGEF DRYFGT Sbjct: 443 RFPSLKIVTSEIDVALNEEYRVIPGMGEFGDRYFGT 478 >ref|XP_007031841.1| Uridine kinase/uracil phosphoribosyltransferase 1 isoform 1 [Theobroma cacao] gi|508710870|gb|EOY02767.1| Uridine kinase/uracil phosphoribosyltransferase 1 isoform 1 [Theobroma cacao] Length = 466 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 KFPFLRLVTSEIDATLDKESRVIPGMGEFADRYFGT 108 +FP L++VTSEID L++E RVIPGMGEF DRYFGT Sbjct: 429 RFPSLKIVTSEIDVALNEEFRVIPGMGEFGDRYFGT 464