BLASTX nr result
ID: Sinomenium22_contig00016017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00016017 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADE77821.1| unknown [Picea sitchensis] 64 2e-08 gb|EGD96857.1| tRNA(His) guanylyltransferase [Trichophyton tonsu... 63 4e-08 gb|EQL37938.1| tRNA(His) guanylyltransferase [Ajellomyces dermat... 62 6e-08 gb|EGE80850.1| tRNA(His) guanylyltransferase [Ajellomyces dermat... 62 6e-08 gb|EER38138.1| tRNA(His) guanylyltransferase [Ajellomyces capsul... 62 6e-08 gb|EEQ89815.1| tRNA(His) guanylyltransferase [Ajellomyces dermat... 62 6e-08 ref|XP_002623622.1| tRNA(His) guanylyltransferase [Ajellomyces d... 62 6e-08 gb|EEH50670.1| tRNA(His) guanylyltransferase [Paracoccidioides b... 62 6e-08 gb|EJB12035.1| tRNA(His) guanylyltransferase [Coccidioides immit... 62 8e-08 ref|XP_001389669.2| tRNA(His) guanylyltransferase [Aspergillus n... 62 8e-08 emb|CAK37314.1| unnamed protein product [Aspergillus niger] 62 8e-08 gb|EZF33282.1| hypothetical protein H101_03131 [Trichophyton int... 62 1e-07 ref|XP_752832.1| tRNAHis guanylyltransferase Thg1 [Aspergillus f... 62 1e-07 emb|CCX04672.1| Similar to tRNA(His) guanylyltransferase; acc. n... 62 1e-07 dbj|GAA86706.1| tRNAHis guanylyltransferase [Aspergillus kawachi... 62 1e-07 ref|XP_004366437.1| tRNA-histidine guanylyltransferase 1 [Dictyo... 62 1e-07 gb|EFW20883.1| tRNAHis guanylyltransferase Thg1 [Coccidioides po... 62 1e-07 gb|EDP56698.1| tRNAHis guanylyltransferase Thg1, putative [Asper... 62 1e-07 ref|XP_001264294.1| tRNAHis guanylyltransferase, putative [Neosa... 62 1e-07 ref|XP_006837790.1| hypothetical protein AMTR_s00104p00090580 [A... 61 1e-07 >gb|ADE77821.1| unknown [Picea sitchensis] Length = 215 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSKYEYVKSFE++D L+P TWIV+RIDG HFH Sbjct: 1 MANSKYEYVKSFELQDNLLPQTWIVLRIDGCHFH 34 >gb|EGD96857.1| tRNA(His) guanylyltransferase [Trichophyton tonsurans CBS 112818] gi|326480445|gb|EGE04455.1| hypothetical protein TEQG_08670 [Trichophyton equinum CBS 127.97] Length = 295 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSKYEYVK+FE DKL+P+TWIV+RIDGR FH Sbjct: 1 MANSKYEYVKNFEQSDKLLPNTWIVIRIDGRGFH 34 >gb|EQL37938.1| tRNA(His) guanylyltransferase [Ajellomyces dermatitidis ATCC 26199] Length = 331 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSKYEYVK+FE +D L+P+TWIVVRIDGR FH Sbjct: 35 MANSKYEYVKAFEQDDSLLPNTWIVVRIDGRGFH 68 >gb|EGE80850.1| tRNA(His) guanylyltransferase [Ajellomyces dermatitidis ATCC 18188] Length = 297 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSKYEYVK+FE +D L+P+TWIVVRIDGR FH Sbjct: 1 MANSKYEYVKAFEQDDSLLPNTWIVVRIDGRGFH 34 >gb|EER38138.1| tRNA(His) guanylyltransferase [Ajellomyces capsulatus H143] Length = 292 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSKYEYVK+FE +D L+P+TWIVVRIDGR FH Sbjct: 1 MANSKYEYVKTFEQDDSLLPNTWIVVRIDGRGFH 34 >gb|EEQ89815.1| tRNA(His) guanylyltransferase [Ajellomyces dermatitidis ER-3] Length = 239 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSKYEYVK+FE +D L+P+TWIVVRIDGR FH Sbjct: 1 MANSKYEYVKAFEQDDSLLPNTWIVVRIDGRGFH 34 >ref|XP_002623622.1| tRNA(His) guanylyltransferase [Ajellomyces dermatitidis SLH14081] gi|239588636|gb|EEQ71279.1| tRNA(His) guanylyltransferase [Ajellomyces dermatitidis SLH14081] Length = 349 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSKYEYVK+FE +D L+P+TWIVVRIDGR FH Sbjct: 1 MANSKYEYVKAFEQDDSLLPNTWIVVRIDGRGFH 34 >gb|EEH50670.1| tRNA(His) guanylyltransferase [Paracoccidioides brasiliensis Pb18] Length = 291 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSKYEYVK+FE +D L+P+TWIVVRIDGR FH Sbjct: 1 MANSKYEYVKAFEQDDNLLPNTWIVVRIDGRGFH 34 >gb|EJB12035.1| tRNA(His) guanylyltransferase [Coccidioides immitis RS] Length = 298 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSKYEYVKSFE +D L+P+TW+VVRIDGR FH Sbjct: 1 MANSKYEYVKSFERDDVLLPNTWVVVRIDGRGFH 34 >ref|XP_001389669.2| tRNA(His) guanylyltransferase [Aspergillus niger CBS 513.88] Length = 296 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSKYEYVKSFE D L+P+TWIVVRIDGR FH Sbjct: 1 MANSKYEYVKSFEQPDALLPNTWIVVRIDGRGFH 34 >emb|CAK37314.1| unnamed protein product [Aspergillus niger] Length = 281 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSKYEYVKSFE D L+P+TWIVVRIDGR FH Sbjct: 1 MANSKYEYVKSFEQPDALLPNTWIVVRIDGRGFH 34 >gb|EZF33282.1| hypothetical protein H101_03131 [Trichophyton interdigitale H6] Length = 295 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSKYEYVK+FE D+L+P+TWIV+RIDGR FH Sbjct: 1 MANSKYEYVKNFEQSDELLPNTWIVIRIDGRGFH 34 >ref|XP_752832.1| tRNAHis guanylyltransferase Thg1 [Aspergillus fumigatus Af293] gi|66850467|gb|EAL90794.1| tRNAHis guanylyltransferase Thg1, putative [Aspergillus fumigatus Af293] Length = 372 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSKYEYVKSFE D L+P+TWIVVRIDGR FH Sbjct: 67 MANSKYEYVKSFEQPDVLLPNTWIVVRIDGRGFH 100 >emb|CCX04672.1| Similar to tRNA(His) guanylyltransferase; acc. no. Q7SDM8 [Pyronema omphalodes CBS 100304] Length = 276 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSK+EYVK+FE +D+++PSTWIVVRIDGR FH Sbjct: 1 MANSKFEYVKAFERDDRILPSTWIVVRIDGRGFH 34 >dbj|GAA86706.1| tRNAHis guanylyltransferase [Aspergillus kawachii IFO 4308] Length = 293 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSKYEYVKSFE D L+P+TWIVVRIDGR FH Sbjct: 1 MANSKYEYVKSFEQPDVLLPNTWIVVRIDGRGFH 34 >ref|XP_004366437.1| tRNA-histidine guanylyltransferase 1 [Dictyostelium fasciculatum] gi|328870158|gb|EGG18533.1| tRNA-histidine guanylyltransferase 1 [Dictyostelium fasciculatum] Length = 258 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSKYEYVK+FE+ D L+P+TWIVVR+DGR FH Sbjct: 1 MANSKYEYVKAFEMPDTLIPNTWIVVRVDGRSFH 34 >gb|EFW20883.1| tRNAHis guanylyltransferase Thg1 [Coccidioides posadasii str. Silveira] Length = 298 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSKYEYVKSFE +D L+P+TW+V+RIDGR FH Sbjct: 1 MANSKYEYVKSFERDDVLLPNTWVVIRIDGRGFH 34 >gb|EDP56698.1| tRNAHis guanylyltransferase Thg1, putative [Aspergillus fumigatus A1163] Length = 374 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSKYEYVKSFE D L+P+TWIVVRIDGR FH Sbjct: 67 MANSKYEYVKSFEQPDVLLPNTWIVVRIDGRGFH 100 >ref|XP_001264294.1| tRNAHis guanylyltransferase, putative [Neosartorya fischeri NRRL 181] gi|119412456|gb|EAW22397.1| tRNAHis guanylyltransferase, putative [Neosartorya fischeri NRRL 181] Length = 291 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHFH 3 MANSKYEYVKSFE D L+P+TWIVVRIDGR FH Sbjct: 1 MANSKYEYVKSFEQPDVLLPNTWIVVRIDGRGFH 34 >ref|XP_006837790.1| hypothetical protein AMTR_s00104p00090580 [Amborella trichopoda] gi|548840156|gb|ERN00359.1| hypothetical protein AMTR_s00104p00090580 [Amborella trichopoda] Length = 256 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 104 MANSKYEYVKSFEVEDKLMPSTWIVVRIDGRHF 6 MANSKYEYVKSFE+ D L+PSTWI+VRIDGR F Sbjct: 1 MANSKYEYVKSFELPDNLLPSTWIIVRIDGRGF 33