BLASTX nr result
ID: Sinomenium22_contig00015628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00015628 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006348098.1| PREDICTED: pentatricopeptide repeat-containi... 157 1e-36 ref|XP_002280513.1| PREDICTED: pentatricopeptide repeat-containi... 153 3e-35 ref|XP_004233792.1| PREDICTED: uncharacterized protein LOC101257... 152 5e-35 ref|XP_006494311.1| PREDICTED: pentatricopeptide repeat-containi... 149 5e-34 ref|XP_006451265.1| hypothetical protein CICLE_v10008215mg [Citr... 149 5e-34 ref|XP_004307867.1| PREDICTED: pentatricopeptide repeat-containi... 148 9e-34 ref|XP_006381760.1| hypothetical protein POPTR_0006s177402g, par... 147 1e-33 gb|EYU30720.1| hypothetical protein MIMGU_mgv1a026030mg [Mimulus... 146 3e-33 ref|XP_004503475.1| PREDICTED: pentatricopeptide repeat-containi... 144 1e-32 ref|XP_002889127.1| pentatricopeptide repeat-containing protein ... 142 4e-32 ref|NP_177842.1| pentatricopeptide repeat-containing protein [Ar... 141 8e-32 ref|XP_002514235.1| pentatricopeptide repeat-containing protein,... 140 1e-31 ref|XP_004162737.1| PREDICTED: pentatricopeptide repeat-containi... 139 5e-31 ref|XP_004135378.1| PREDICTED: pentatricopeptide repeat-containi... 139 5e-31 ref|XP_006300895.1| hypothetical protein CARUB_v10021262mg [Caps... 138 9e-31 ref|XP_003630737.1| Pentatricopeptide repeat-containing protein ... 137 2e-30 ref|XP_006390118.1| hypothetical protein EUTSA_v10018483mg [Eutr... 136 3e-30 gb|AFK47126.1| unknown [Medicago truncatula] 135 8e-30 ref|XP_007160298.1| hypothetical protein PHAVU_002G309900g [Phas... 134 2e-29 gb|EPS67797.1| hypothetical protein M569_06976 [Genlisea aurea] 126 4e-27 >ref|XP_006348098.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77170-like [Solanum tuberosum] Length = 456 Score = 157 bits (397), Expect = 1e-36 Identities = 76/100 (76%), Positives = 92/100 (92%) Frame = -3 Query: 302 AKEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMS 123 AKEAI MF+EL + GL+PDDVTMVSVTSACGSLGDL+LA QLHKCVFQAK +E+ D+LM Sbjct: 188 AKEAIEMFLELRESGLQPDDVTMVSVTSACGSLGDLDLASQLHKCVFQAKEMERSDLLMM 247 Query: 122 NSLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIMGYA 3 NSLIDMYGKCG+MDLA++VF+RM ++R+VS+WTSMI+GYA Sbjct: 248 NSLIDMYGKCGKMDLAYRVFSRM-KERNVSSWTSMIVGYA 286 >ref|XP_002280513.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77170 [Vitis vinifera] gi|297738768|emb|CBI28013.3| unnamed protein product [Vitis vinifera] Length = 479 Score = 153 bits (386), Expect = 3e-35 Identities = 73/100 (73%), Positives = 89/100 (89%) Frame = -3 Query: 302 AKEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMS 123 AKEA++MF+E+ KCG EPD+VTMVSVTSACGSLG L+LALQLHKCV+QAKT E+ D L Sbjct: 211 AKEAVTMFMEMRKCGFEPDEVTMVSVTSACGSLGHLDLALQLHKCVYQAKTSERSDTLTL 270 Query: 122 NSLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIMGYA 3 NSL+DMYGKCGRMDLA++VF+RM + +VS+WTSMI+GYA Sbjct: 271 NSLVDMYGKCGRMDLAYRVFSRMDEP-NVSSWTSMIVGYA 309 >ref|XP_004233792.1| PREDICTED: uncharacterized protein LOC101257235 [Solanum lycopersicum] Length = 1917 Score = 152 bits (384), Expect = 5e-35 Identities = 74/100 (74%), Positives = 90/100 (90%) Frame = -3 Query: 302 AKEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMS 123 AKEAI MF+EL + GL+PDDVTMVS TSACGSLGDL+LA QLHKCVFQAK +E+ D+LM Sbjct: 1493 AKEAIEMFLELRESGLQPDDVTMVSATSACGSLGDLDLASQLHKCVFQAKEMERSDLLMM 1552 Query: 122 NSLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIMGYA 3 NSLIDMYGKCG+MDLA++VF+RM ++R+VS+WTSMI+G A Sbjct: 1553 NSLIDMYGKCGKMDLAYRVFSRM-KERNVSSWTSMIVGCA 1591 >ref|XP_006494311.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77170-like [Citrus sinensis] Length = 471 Score = 149 bits (375), Expect = 5e-34 Identities = 76/100 (76%), Positives = 84/100 (84%) Frame = -3 Query: 302 AKEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMS 123 AKEAI MFI L KCG EPDDVTMVSVTSACGSLGDL LALQ+HK VFQ K+ +K D LM Sbjct: 203 AKEAIDMFIGLKKCGFEPDDVTMVSVTSACGSLGDLELALQVHKYVFQVKSKQKSDTLML 262 Query: 122 NSLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIMGYA 3 NSLIDMYGKCGRMDLA+KVF + Q +VS+WTSMI+GYA Sbjct: 263 NSLIDMYGKCGRMDLAYKVFWEIDQP-NVSSWTSMIVGYA 301 >ref|XP_006451265.1| hypothetical protein CICLE_v10008215mg [Citrus clementina] gi|557554491|gb|ESR64505.1| hypothetical protein CICLE_v10008215mg [Citrus clementina] Length = 461 Score = 149 bits (375), Expect = 5e-34 Identities = 76/100 (76%), Positives = 84/100 (84%) Frame = -3 Query: 302 AKEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMS 123 AKEAI MFI L KCG EPDDVTMVSVTSACGSLGDL LALQ+HK VFQ K+ +K D LM Sbjct: 193 AKEAIDMFIGLKKCGFEPDDVTMVSVTSACGSLGDLELALQVHKYVFQVKSKQKSDTLML 252 Query: 122 NSLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIMGYA 3 NSLIDMYGKCGRMDLA+KVF + Q +VS+WTSMI+GYA Sbjct: 253 NSLIDMYGKCGRMDLAYKVFWEIDQP-NVSSWTSMIVGYA 291 >ref|XP_004307867.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77170-like [Fragaria vesca subsp. vesca] Length = 468 Score = 148 bits (373), Expect = 9e-34 Identities = 75/101 (74%), Positives = 87/101 (86%), Gaps = 1/101 (0%) Frame = -3 Query: 302 AKEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAK-TLEKPDILM 126 AKEAI MFIEL +CGL PDDVTMVSVTSACG LGDL LALQLHKCV+QA+ K D+LM Sbjct: 199 AKEAIDMFIELRRCGLLPDDVTMVSVTSACGGLGDLRLALQLHKCVYQAEIAAGKSDLLM 258 Query: 125 SNSLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIMGYA 3 NSL+DMYGKCGRMDLA++VF RM + ++VS+WTSMI+GYA Sbjct: 259 LNSLVDMYGKCGRMDLAYRVFKRM-KVQNVSSWTSMIVGYA 298 >ref|XP_006381760.1| hypothetical protein POPTR_0006s177402g, partial [Populus trichocarpa] gi|550336514|gb|ERP59557.1| hypothetical protein POPTR_0006s177402g, partial [Populus trichocarpa] Length = 221 Score = 147 bits (372), Expect = 1e-33 Identities = 74/96 (77%), Positives = 83/96 (86%) Frame = -3 Query: 302 AKEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMS 123 AKE I MFIE+ CG +PDDVTMVSVTSACG LGDL+LALQLHK VFQAK+ KPD+LM Sbjct: 127 AKEVIEMFIEMRSCGFKPDDVTMVSVTSACGILGDLHLALQLHKYVFQAKSFVKPDMLML 186 Query: 122 NSLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMI 15 NSLIDMYGKCGRMDLA+ VF+RM Q R+VS+WTSMI Sbjct: 187 NSLIDMYGKCGRMDLAYMVFSRMDQ-RNVSSWTSMI 221 >gb|EYU30720.1| hypothetical protein MIMGU_mgv1a026030mg [Mimulus guttatus] Length = 435 Score = 146 bits (368), Expect = 3e-33 Identities = 73/100 (73%), Positives = 82/100 (82%) Frame = -3 Query: 302 AKEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMS 123 +KEAI MF +M+ G PDDVTMVSVTSACGSLGD NLALQLHKCVFQAK E+ D+LM Sbjct: 171 SKEAIDMFQSMMRDGFRPDDVTMVSVTSACGSLGDFNLALQLHKCVFQAKNPERSDLLMM 230 Query: 122 NSLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIMGYA 3 NS+IDMYGKCGRMDLA K F M K +VS+WTSMI+GYA Sbjct: 231 NSVIDMYGKCGRMDLACKAFVTMEDK-NVSSWTSMIVGYA 269 >ref|XP_004503475.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77170-like [Cicer arietinum] Length = 451 Score = 144 bits (363), Expect = 1e-32 Identities = 71/100 (71%), Positives = 86/100 (86%) Frame = -3 Query: 302 AKEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMS 123 A +AI +F+++ + G EP+ +TMVSV SACGS+GDL LALQLHKCVFQA+ EK DILMS Sbjct: 183 AVDAIYVFVDMRRQGFEPNGITMVSVMSACGSIGDLYLALQLHKCVFQAEATEKTDILMS 242 Query: 122 NSLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIMGYA 3 NSLIDMYGKCGRMDLA+KVFA M + R+VS+WTSMI+GYA Sbjct: 243 NSLIDMYGKCGRMDLAYKVFATM-EDRNVSSWTSMIVGYA 281 >ref|XP_002889127.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297334968|gb|EFH65386.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 466 Score = 142 bits (359), Expect = 4e-32 Identities = 70/100 (70%), Positives = 80/100 (80%) Frame = -3 Query: 302 AKEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMS 123 A EA+ MF+E+ + G EPDD TMVSVTSACG LGDLNLA QLHKCV QAKT EK D++M Sbjct: 198 ANEAVEMFMEMRRSGFEPDDFTMVSVTSACGGLGDLNLAFQLHKCVLQAKTEEKSDVMMM 257 Query: 122 NSLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIMGYA 3 NSLIDMYGKCGRMD A +VF M Q R+V +W+SMI GYA Sbjct: 258 NSLIDMYGKCGRMDFAIQVFEEMPQ-RNVVSWSSMITGYA 296 >ref|NP_177842.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122215262|sp|Q3ECB8.1|PP128_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g77170 gi|332197823|gb|AEE35944.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 467 Score = 141 bits (356), Expect = 8e-32 Identities = 68/100 (68%), Positives = 82/100 (82%) Frame = -3 Query: 302 AKEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMS 123 A EA+ MF+++ + GLEPDD TMVSVT++CG LGDL+LA QLHKCV QAKT EK DI+M Sbjct: 199 ANEAVEMFVDMKRSGLEPDDFTMVSVTASCGGLGDLSLAFQLHKCVLQAKTEEKSDIMML 258 Query: 122 NSLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIMGYA 3 NSLIDMYGKCGRMDLA +F M Q R+V +W+SMI+GYA Sbjct: 259 NSLIDMYGKCGRMDLASHIFEEMRQ-RNVVSWSSMIVGYA 297 >ref|XP_002514235.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546691|gb|EEF48189.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 352 Score = 140 bits (354), Expect = 1e-31 Identities = 70/99 (70%), Positives = 81/99 (81%) Frame = -3 Query: 302 AKEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMS 123 AKEAI +FIE+ KCG PDDVTMVSV SACGSLGDLNLA+QLHK VF A + +IL+ Sbjct: 205 AKEAIEIFIEMRKCGFVPDDVTMVSVISACGSLGDLNLAIQLHKYVFHANVFGRTNILVM 264 Query: 122 NSLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIMGY 6 NSLIDMYGKCGRMDLA +VF M +K +VS+WTSMI+GY Sbjct: 265 NSLIDMYGKCGRMDLARRVFCTMGEK-NVSSWTSMIVGY 302 >ref|XP_004162737.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77170-like [Cucumis sativus] Length = 614 Score = 139 bits (349), Expect = 5e-31 Identities = 70/100 (70%), Positives = 84/100 (84%) Frame = -3 Query: 302 AKEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMS 123 AKEA++MFI+L + GLEPDD T+VSVTSACGSLG+L L+LQ+HK VFQ K K +ILM Sbjct: 346 AKEAVNMFIKLRQSGLEPDDFTIVSVTSACGSLGNLELSLQMHKFVFQVKVTGKSNILML 405 Query: 122 NSLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIMGYA 3 NSLIDMYGKCGRMDLA KVF+ M R+VS+WTS+I+GYA Sbjct: 406 NSLIDMYGKCGRMDLAMKVFSNMGH-RNVSSWTSLIVGYA 444 >ref|XP_004135378.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77170-like [Cucumis sativus] Length = 609 Score = 139 bits (349), Expect = 5e-31 Identities = 70/100 (70%), Positives = 84/100 (84%) Frame = -3 Query: 302 AKEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMS 123 AKEA++MFI+L + GLEPDD T+VSVTSACGSLG+L L+LQ+HK VFQ K K +ILM Sbjct: 341 AKEAVNMFIKLRQSGLEPDDFTIVSVTSACGSLGNLELSLQMHKFVFQVKVTGKSNILML 400 Query: 122 NSLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIMGYA 3 NSLIDMYGKCGRMDLA KVF+ M R+VS+WTS+I+GYA Sbjct: 401 NSLIDMYGKCGRMDLAMKVFSNMGH-RNVSSWTSLIVGYA 439 >ref|XP_006300895.1| hypothetical protein CARUB_v10021262mg [Capsella rubella] gi|482569605|gb|EOA33793.1| hypothetical protein CARUB_v10021262mg [Capsella rubella] Length = 464 Score = 138 bits (347), Expect = 9e-31 Identities = 68/100 (68%), Positives = 81/100 (81%) Frame = -3 Query: 302 AKEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMS 123 A EA+ MF+E+ K G EPDD TMVSVTSACG LG+L+LA QLHKCV QAK+ +K DI+M Sbjct: 196 ASEAVEMFMEMKKSGFEPDDFTMVSVTSACGRLGNLSLAFQLHKCVLQAKSEDKSDIMMM 255 Query: 122 NSLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIMGYA 3 NSLIDMYGKCGRMDLA +VF +M Q R+V +W+SMI YA Sbjct: 256 NSLIDMYGKCGRMDLASQVFEKMPQ-RNVVSWSSMITSYA 294 >ref|XP_003630737.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355524759|gb|AET05213.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 447 Score = 137 bits (344), Expect = 2e-30 Identities = 70/100 (70%), Positives = 84/100 (84%) Frame = -3 Query: 302 AKEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMS 123 A +AI +F+++ + G EPD +TMVSV SACGS+GDL LALQLHK VFQAKT E ILMS Sbjct: 179 AMDAIVVFVDMKRHGFEPDGITMVSVMSACGSIGDLYLALQLHKYVFQAKTNEWTVILMS 238 Query: 122 NSLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIMGYA 3 NSLIDMYGKCGRMDLA++VFA M + R+VS+WTSMI+GYA Sbjct: 239 NSLIDMYGKCGRMDLAYEVFATM-EDRNVSSWTSMIVGYA 277 >ref|XP_006390118.1| hypothetical protein EUTSA_v10018483mg [Eutrema salsugineum] gi|557086552|gb|ESQ27404.1| hypothetical protein EUTSA_v10018483mg [Eutrema salsugineum] Length = 476 Score = 136 bits (343), Expect = 3e-30 Identities = 67/100 (67%), Positives = 80/100 (80%) Frame = -3 Query: 302 AKEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMS 123 A EA+ MF+E+ + G EPDD TMVSVTSACGSLG+L+LA QLH+CV +AK EK D +M Sbjct: 208 ANEAVEMFVEMKRNGFEPDDFTMVSVTSACGSLGNLSLAFQLHRCVLEAKPEEKSDTMMM 267 Query: 122 NSLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIMGYA 3 NSLID+YGKCGRMDLA +VF M R+V +WTSMIMGYA Sbjct: 268 NSLIDVYGKCGRMDLASQVFDEMPH-RNVVSWTSMIMGYA 306 >gb|AFK47126.1| unknown [Medicago truncatula] Length = 447 Score = 135 bits (339), Expect = 8e-30 Identities = 69/100 (69%), Positives = 83/100 (83%) Frame = -3 Query: 302 AKEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMS 123 A +AI +F+++ + G EPD +TMVSV ACGS+GDL LALQLHK VFQAKT E ILMS Sbjct: 179 AMDAIVVFVDMKRHGFEPDGITMVSVMCACGSIGDLYLALQLHKYVFQAKTNEWTVILMS 238 Query: 122 NSLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIMGYA 3 NSLIDMYGKCGRMDLA++VFA M + R+VS+WTSMI+GYA Sbjct: 239 NSLIDMYGKCGRMDLAYEVFATM-EDRNVSSWTSMIVGYA 277 >ref|XP_007160298.1| hypothetical protein PHAVU_002G309900g [Phaseolus vulgaris] gi|561033713|gb|ESW32292.1| hypothetical protein PHAVU_002G309900g [Phaseolus vulgaris] Length = 423 Score = 134 bits (336), Expect = 2e-29 Identities = 63/96 (65%), Positives = 82/96 (85%) Frame = -3 Query: 299 KEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMSN 120 ++AIS+F+++ + G PD +TMV+VTSACG +GDLNLALQLHKCVFQ + E+ D+LM N Sbjct: 190 RDAISVFLDMRRRGFAPDGLTMVNVTSACGKIGDLNLALQLHKCVFQVEAGERTDVLMLN 249 Query: 119 SLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIM 12 SLIDMYGKCGR+DLA+KVFA M ++R VS+WTSMI+ Sbjct: 250 SLIDMYGKCGRLDLAYKVFATM-EERSVSSWTSMIV 284 >gb|EPS67797.1| hypothetical protein M569_06976 [Genlisea aurea] Length = 503 Score = 126 bits (316), Expect = 4e-27 Identities = 57/99 (57%), Positives = 80/99 (80%) Frame = -3 Query: 299 KEAISMFIELMKCGLEPDDVTMVSVTSACGSLGDLNLALQLHKCVFQAKTLEKPDILMSN 120 KEA+ MF+ +M+ G+ PDD+T+V +TS C ++G+LNLA+QLHK V Q K + D+LM N Sbjct: 234 KEALDMFLSMMRTGIVPDDITIVCLTSNCAAIGNLNLAMQLHKFVLQVKISSRTDLLMMN 293 Query: 119 SLIDMYGKCGRMDLAHKVFARMTQKRDVSTWTSMIMGYA 3 SL+DMYGKCGRMDLA++VF + + ++VS+WTSMI+GYA Sbjct: 294 SLVDMYGKCGRMDLAYRVFTEI-EVKNVSSWTSMIVGYA 331