BLASTX nr result
ID: Sinomenium22_contig00015119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00015119 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514949.1| OTU domain-containing protein 6B, putative [... 74 2e-11 ref|XP_007045037.1| Cysteine proteinases superfamily protein iso... 69 5e-10 ref|XP_004310203.1| PREDICTED: OTU domain-containing protein At3... 69 5e-10 ref|XP_006850126.1| hypothetical protein AMTR_s00022p00229870 [A... 68 1e-09 ref|XP_002534273.1| cysteine-type peptidase, putative [Ricinus c... 68 1e-09 gb|EXC30911.1| OTU domain-containing protein [Morus notabilis] 67 2e-09 ref|XP_006379933.1| hypothetical protein POPTR_0008s17740g [Popu... 67 2e-09 ref|XP_002311721.2| hypothetical protein POPTR_0008s17740g [Popu... 67 2e-09 ref|XP_007045036.1| Cysteine proteinases superfamily protein iso... 67 2e-09 ref|XP_006379934.1| hypothetical protein POPTR_0008s17740g [Popu... 67 3e-09 ref|XP_007202322.1| hypothetical protein PRUPE_ppa008123mg [Prun... 67 3e-09 gb|EYU42104.1| hypothetical protein MIMGU_mgv1a025113mg, partial... 66 4e-09 ref|XP_006438078.1| hypothetical protein CICLE_v10032840mg [Citr... 66 6e-09 ref|XP_003632695.1| PREDICTED: OTU domain-containing protein At3... 66 6e-09 emb|CBI29898.3| unnamed protein product [Vitis vinifera] 66 6e-09 emb|CAN60311.1| hypothetical protein VITISV_002512 [Vitis vinifera] 66 6e-09 ref|XP_006438079.1| hypothetical protein CICLE_v10032840mg [Citr... 65 1e-08 ref|XP_004497941.1| PREDICTED: OTU domain-containing protein At3... 65 1e-08 ref|XP_002323302.2| OTU-like cysteine protease family protein [P... 65 1e-08 ref|XP_007145652.1| hypothetical protein PHAVU_007G257000g [Phas... 64 2e-08 >ref|XP_002514949.1| OTU domain-containing protein 6B, putative [Ricinus communis] gi|223546000|gb|EEF47503.1| OTU domain-containing protein 6B, putative [Ricinus communis] Length = 167 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +2 Query: 158 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 TGI GDGRCLFRSV HGA LREGKPSP E ++KELADELRAK Sbjct: 24 TGIPGDGRCLFRSVVHGACLREGKPSPTESLEKELADELRAK 65 >ref|XP_007045037.1| Cysteine proteinases superfamily protein isoform 2, partial [Theobroma cacao] gi|508708972|gb|EOY00869.1| Cysteine proteinases superfamily protein isoform 2, partial [Theobroma cacao] Length = 165 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/42 (80%), Positives = 35/42 (83%) Frame = +2 Query: 158 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 TGI GDGRCLFRSV HGA+LR GK SP E QKELADELRAK Sbjct: 18 TGIPGDGRCLFRSVVHGAWLRAGKQSPSESHQKELADELRAK 59 >ref|XP_004310203.1| PREDICTED: OTU domain-containing protein At3g57810-like [Fragaria vesca subsp. vesca] Length = 164 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = +2 Query: 152 TWTGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 T GI GDGRCLFRSV HGA LR GKPSP + QKELAD+LRAK Sbjct: 6 TMLGIRGDGRCLFRSVVHGACLRAGKPSPSDSYQKELADDLRAK 49 >ref|XP_006850126.1| hypothetical protein AMTR_s00022p00229870 [Amborella trichopoda] gi|548853724|gb|ERN11707.1| hypothetical protein AMTR_s00022p00229870 [Amborella trichopoda] Length = 244 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +2 Query: 158 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 TGI GDGRC+FRSV HGA LR GKP P E VQ+E+ADELRA+ Sbjct: 107 TGIPGDGRCMFRSVAHGACLRSGKPPPNESVQREMADELRAR 148 >ref|XP_002534273.1| cysteine-type peptidase, putative [Ricinus communis] gi|223525596|gb|EEF28110.1| cysteine-type peptidase, putative [Ricinus communis] Length = 343 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 158 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 TGI GDGRCLFRSV HGA LR GKP+P E +Q+ELAD+LRA+ Sbjct: 199 TGIPGDGRCLFRSVAHGASLRTGKPAPSESLQRELADDLRAR 240 >gb|EXC30911.1| OTU domain-containing protein [Morus notabilis] Length = 893 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +2 Query: 158 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 TGI GDGRCLFRSV HGA LR GKP+P E +Q+ELAD LRA+ Sbjct: 749 TGIPGDGRCLFRSVAHGACLRSGKPAPSESLQRELADNLRAR 790 >ref|XP_006379933.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] gi|550333320|gb|ERP57730.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] Length = 163 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = +2 Query: 152 TWTGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 T GI GDGRCLFRSV HGA LR GKPSP E ++KELADELR K Sbjct: 14 TALGIPGDGRCLFRSVVHGACLRTGKPSPSESLEKELADELRDK 57 >ref|XP_002311721.2| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] gi|550333319|gb|EEE89088.2| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] Length = 163 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = +2 Query: 152 TWTGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 T GI GDGRCLFRSV HGA LR GKPSP E ++KELADELR K Sbjct: 14 TALGIPGDGRCLFRSVVHGACLRTGKPSPSESLEKELADELRDK 57 >ref|XP_007045036.1| Cysteine proteinases superfamily protein isoform 1 [Theobroma cacao] gi|508708971|gb|EOY00868.1| Cysteine proteinases superfamily protein isoform 1 [Theobroma cacao] Length = 175 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = +2 Query: 161 GIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 GI GDGRCLFRSV HGA+LR GK SP E QKELADELRAK Sbjct: 29 GIPGDGRCLFRSVVHGAWLRAGKQSPSESHQKELADELRAK 69 >ref|XP_006379934.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] gi|550333321|gb|ERP57731.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] Length = 155 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = +2 Query: 161 GIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 GI GDGRCLFRSV HGA LR GKPSP E ++KELADELR K Sbjct: 9 GIPGDGRCLFRSVVHGACLRTGKPSPSESLEKELADELRDK 49 >ref|XP_007202322.1| hypothetical protein PRUPE_ppa008123mg [Prunus persica] gi|462397853|gb|EMJ03521.1| hypothetical protein PRUPE_ppa008123mg [Prunus persica] Length = 344 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +2 Query: 161 GIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 GI GDGRCLFRSV HGAYLR GK +P E +Q+ELAD+LRA+ Sbjct: 201 GIPGDGRCLFRSVAHGAYLRAGKAAPAESLQRELADDLRAR 241 >gb|EYU42104.1| hypothetical protein MIMGU_mgv1a025113mg, partial [Mimulus guttatus] Length = 147 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = +2 Query: 158 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRA 280 +GI GDGRCLFRSV HGA LR GKPSP E +KELADELRA Sbjct: 5 SGIPGDGRCLFRSVVHGACLRAGKPSPSEIHEKELADELRA 45 >ref|XP_006438078.1| hypothetical protein CICLE_v10032840mg [Citrus clementina] gi|557540274|gb|ESR51318.1| hypothetical protein CICLE_v10032840mg [Citrus clementina] Length = 189 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +2 Query: 152 TWTGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 T GI GDGRCLFRSV HGA+LR G+ SP + +Q+ELADELRAK Sbjct: 40 TSVGIAGDGRCLFRSVIHGAWLRAGRQSPSDSLQRELADELRAK 83 >ref|XP_003632695.1| PREDICTED: OTU domain-containing protein At3g57810-like [Vitis vinifera] Length = 340 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = +2 Query: 158 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 TGI GDGRCLFRSV HGA LR GKP+P Q+ELADELRA+ Sbjct: 196 TGIPGDGRCLFRSVVHGACLRSGKPAPSASCQRELADELRAE 237 >emb|CBI29898.3| unnamed protein product [Vitis vinifera] Length = 189 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = +2 Query: 158 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 TGI GDGRCLFRSV HGA LR GKP+P Q+ELADELRA+ Sbjct: 45 TGIPGDGRCLFRSVVHGACLRSGKPAPSASCQRELADELRAE 86 >emb|CAN60311.1| hypothetical protein VITISV_002512 [Vitis vinifera] Length = 806 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = +2 Query: 158 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 TGI GDGRCLFRSV HGA LR GKP+P Q+ELADELRA+ Sbjct: 662 TGIPGDGRCLFRSVVHGACLRSGKPAPSASCQRELADELRAE 703 >ref|XP_006438079.1| hypothetical protein CICLE_v10032840mg [Citrus clementina] gi|568861142|ref|XP_006484065.1| PREDICTED: OTU domain-containing protein At3g57810-like isoform X1 [Citrus sinensis] gi|557540275|gb|ESR51319.1| hypothetical protein CICLE_v10032840mg [Citrus clementina] Length = 152 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +2 Query: 161 GIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 GI GDGRCLFRSV HGA+LR G+ SP + +Q+ELADELRAK Sbjct: 6 GIAGDGRCLFRSVIHGAWLRAGRQSPSDSLQRELADELRAK 46 >ref|XP_004497941.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cicer arietinum] Length = 337 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +2 Query: 161 GIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 GI GDGRCLFRSV HGA LR GKP P E Q+ELAD+LRAK Sbjct: 194 GIPGDGRCLFRSVAHGASLRSGKPPPSERFQRELADDLRAK 234 >ref|XP_002323302.2| OTU-like cysteine protease family protein [Populus trichocarpa] gi|550320875|gb|EEF05063.2| OTU-like cysteine protease family protein [Populus trichocarpa] Length = 342 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +2 Query: 161 GIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 GI GDGRCLFRSV HGA +R GKP+P E +Q+ELAD+LR+K Sbjct: 199 GIPGDGRCLFRSVAHGACIRSGKPAPSENLQRELADDLRSK 239 >ref|XP_007145652.1| hypothetical protein PHAVU_007G257000g [Phaseolus vulgaris] gi|561018842|gb|ESW17646.1| hypothetical protein PHAVU_007G257000g [Phaseolus vulgaris] Length = 339 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +2 Query: 161 GIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELADELRAK 283 GI GDGRCLFRSV+ GA LR GKP P E VQ+ELAD+LRA+ Sbjct: 196 GIPGDGRCLFRSVSRGACLRSGKPPPTESVQRELADDLRAR 236