BLASTX nr result
ID: Sinomenium22_contig00015036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00015036 (1203 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17361.3| unnamed protein product [Vitis vinifera] 60 2e-06 ref|XP_002265670.1| PREDICTED: E3 ubiquitin-protein ligase RNF16... 60 2e-06 ref|XP_006466970.1| PREDICTED: E3 ubiquitin-protein ligase RNF13... 58 9e-06 ref|XP_006466968.1| PREDICTED: E3 ubiquitin-protein ligase RNF13... 58 9e-06 ref|XP_006425439.1| hypothetical protein CICLE_v10025842mg [Citr... 58 9e-06 ref|XP_006425438.1| hypothetical protein CICLE_v10025842mg [Citr... 58 9e-06 >emb|CBI17361.3| unnamed protein product [Vitis vinifera] Length = 352 Score = 60.1 bits (144), Expect = 2e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +1 Query: 4 FHASCVGSWLTKWGTFCPVCKHEISAGSAGHLVSER 111 FHASCV SWLTKWGTFCPVCK+++S + V+ER Sbjct: 311 FHASCVDSWLTKWGTFCPVCKYDLSTDATCSKVNER 346 >ref|XP_002265670.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Vitis vinifera] Length = 294 Score = 60.1 bits (144), Expect = 2e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +1 Query: 4 FHASCVGSWLTKWGTFCPVCKHEISAGSAGHLVSER 111 FHASCV SWLTKWGTFCPVCK+++S + V+ER Sbjct: 253 FHASCVDSWLTKWGTFCPVCKYDLSTDATCSKVNER 288 >ref|XP_006466970.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like isoform X3 [Citrus sinensis] gi|568825199|ref|XP_006466971.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like isoform X4 [Citrus sinensis] Length = 353 Score = 57.8 bits (138), Expect = 9e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +1 Query: 4 FHASCVGSWLTKWGTFCPVCKHEISAGSAGHLV 102 FHASCV SWLTKWGTFCPVCKH++ S + V Sbjct: 319 FHASCVDSWLTKWGTFCPVCKHDMRNNSESNEV 351 >ref|XP_006466968.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like isoform X1 [Citrus sinensis] gi|568825195|ref|XP_006466969.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like isoform X2 [Citrus sinensis] Length = 355 Score = 57.8 bits (138), Expect = 9e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +1 Query: 4 FHASCVGSWLTKWGTFCPVCKHEISAGSAGHLV 102 FHASCV SWLTKWGTFCPVCKH++ S + V Sbjct: 319 FHASCVDSWLTKWGTFCPVCKHDMRNNSESNEV 351 >ref|XP_006425439.1| hypothetical protein CICLE_v10025842mg [Citrus clementina] gi|557527429|gb|ESR38679.1| hypothetical protein CICLE_v10025842mg [Citrus clementina] Length = 351 Score = 57.8 bits (138), Expect = 9e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +1 Query: 4 FHASCVGSWLTKWGTFCPVCKHEISAGSAGHLV 102 FHASCV SWLTKWGTFCPVCKH++ S + V Sbjct: 315 FHASCVDSWLTKWGTFCPVCKHDMRNNSESNEV 347 >ref|XP_006425438.1| hypothetical protein CICLE_v10025842mg [Citrus clementina] gi|567865637|ref|XP_006425441.1| hypothetical protein CICLE_v10025842mg [Citrus clementina] gi|557527428|gb|ESR38678.1| hypothetical protein CICLE_v10025842mg [Citrus clementina] gi|557527431|gb|ESR38681.1| hypothetical protein CICLE_v10025842mg [Citrus clementina] Length = 349 Score = 57.8 bits (138), Expect = 9e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +1 Query: 4 FHASCVGSWLTKWGTFCPVCKHEISAGSAGHLV 102 FHASCV SWLTKWGTFCPVCKH++ S + V Sbjct: 315 FHASCVDSWLTKWGTFCPVCKHDMRNNSESNEV 347