BLASTX nr result
ID: Sinomenium22_contig00014965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00014965 (459 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006584112.1| PREDICTED: calcineurin B-like protein 3-like... 77 2e-12 ref|XP_003529683.1| PREDICTED: calcineurin B-like protein 3-like... 77 2e-12 gb|EXC19711.1| Calcineurin B-like protein 3 [Morus notabilis] 77 3e-12 ref|XP_002316785.2| calcineurin B family protein [Populus tricho... 77 3e-12 ref|XP_006373574.1| hypothetical protein POPTR_0016s00520g [Popu... 77 3e-12 ref|XP_006836851.1| hypothetical protein AMTR_s00099p00079780 [A... 77 3e-12 ref|XP_007026412.1| Calcineurin B-like protein 2 isoform 2 [Theo... 77 3e-12 ref|XP_007026411.1| Calcineurin B-like protein 2 isoform 1 [Theo... 77 3e-12 ref|XP_007020410.1| Calcineurin B-like 3 isoform 4, partial [The... 77 3e-12 ref|XP_007020408.1| Calcineurin B-like 3 isoform 2 [Theobroma ca... 77 3e-12 ref|XP_007020407.1| Calcineurin B-like 3 isoform 1 [Theobroma ca... 77 3e-12 gb|AGM15885.1| calcineurin B-like protein CBL2 [Pyrus betulifoli... 77 3e-12 ref|XP_004294910.1| PREDICTED: calcineurin B-like protein 3-like... 77 3e-12 ref|XP_007205841.1| hypothetical protein PRUPE_ppa011040mg [Prun... 77 3e-12 gb|AAX20387.1| calcineurin B-like protein 3 [Gossypium hirsutum] 77 3e-12 emb|CBI25732.3| unnamed protein product [Vitis vinifera] 77 3e-12 emb|CBI18847.3| unnamed protein product [Vitis vinifera] 77 3e-12 ref|XP_002532178.1| calcineurin B, putative [Ricinus communis] g... 77 3e-12 gb|ABW06390.1| CBL3 [Gossypium hirsutum] gi|157955939|gb|ABW0639... 77 3e-12 gb|ABW06389.1| CBL2 [Gossypium hirsutum] 77 3e-12 >ref|XP_006584112.1| PREDICTED: calcineurin B-like protein 3-like isoform X2 [Glycine max] Length = 213 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E R+LVLQHPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 174 EWRNLVLQHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 213 >ref|XP_003529683.1| PREDICTED: calcineurin B-like protein 3-like isoform X1 [Glycine max] Length = 226 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E R+LVLQHPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 187 EWRNLVLQHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 226 >gb|EXC19711.1| Calcineurin B-like protein 3 [Morus notabilis] Length = 230 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E RSLVL+HPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 191 EWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 230 >ref|XP_002316785.2| calcineurin B family protein [Populus trichocarpa] gi|550328024|gb|EEE97397.2| calcineurin B family protein [Populus trichocarpa] Length = 222 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E RSLVL+HPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 183 EWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 222 >ref|XP_006373574.1| hypothetical protein POPTR_0016s00520g [Populus trichocarpa] gi|550320484|gb|ERP51371.1| hypothetical protein POPTR_0016s00520g [Populus trichocarpa] Length = 199 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E RSLVL+HPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 160 EWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 199 >ref|XP_006836851.1| hypothetical protein AMTR_s00099p00079780 [Amborella trichopoda] gi|548839415|gb|ERM99704.1| hypothetical protein AMTR_s00099p00079780 [Amborella trichopoda] Length = 362 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E RSLVL+HPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 323 EWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 362 >ref|XP_007026412.1| Calcineurin B-like protein 2 isoform 2 [Theobroma cacao] gi|508781778|gb|EOY29034.1| Calcineurin B-like protein 2 isoform 2 [Theobroma cacao] Length = 199 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E RSLVL+HPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 160 EWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 199 >ref|XP_007026411.1| Calcineurin B-like protein 2 isoform 1 [Theobroma cacao] gi|508781777|gb|EOY29033.1| Calcineurin B-like protein 2 isoform 1 [Theobroma cacao] Length = 226 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E RSLVL+HPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 187 EWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 226 >ref|XP_007020410.1| Calcineurin B-like 3 isoform 4, partial [Theobroma cacao] gi|508720038|gb|EOY11935.1| Calcineurin B-like 3 isoform 4, partial [Theobroma cacao] Length = 206 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E RSLVL+HPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 167 EWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 206 >ref|XP_007020408.1| Calcineurin B-like 3 isoform 2 [Theobroma cacao] gi|508720036|gb|EOY11933.1| Calcineurin B-like 3 isoform 2 [Theobroma cacao] Length = 213 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E RSLVL+HPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 174 EWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 213 >ref|XP_007020407.1| Calcineurin B-like 3 isoform 1 [Theobroma cacao] gi|590605114|ref|XP_007020409.1| Calcineurin B-like 3 isoform 1 [Theobroma cacao] gi|508720035|gb|EOY11932.1| Calcineurin B-like 3 isoform 1 [Theobroma cacao] gi|508720037|gb|EOY11934.1| Calcineurin B-like 3 isoform 1 [Theobroma cacao] Length = 226 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E RSLVL+HPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 187 EWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 226 >gb|AGM15885.1| calcineurin B-like protein CBL2 [Pyrus betulifolia] gi|506460120|gb|AGM15886.1| calcineurin B-like protein CBL2 [Pyrus betulifolia] Length = 226 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E RSLVL+HPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 187 EWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 226 >ref|XP_004294910.1| PREDICTED: calcineurin B-like protein 3-like [Fragaria vesca subsp. vesca] Length = 226 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E RSLVL+HPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 187 EWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 226 >ref|XP_007205841.1| hypothetical protein PRUPE_ppa011040mg [Prunus persica] gi|595829264|ref|XP_007205842.1| hypothetical protein PRUPE_ppa011040mg [Prunus persica] gi|462401483|gb|EMJ07040.1| hypothetical protein PRUPE_ppa011040mg [Prunus persica] gi|462401484|gb|EMJ07041.1| hypothetical protein PRUPE_ppa011040mg [Prunus persica] Length = 226 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E RSLVL+HPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 187 EWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 226 >gb|AAX20387.1| calcineurin B-like protein 3 [Gossypium hirsutum] Length = 226 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E RSLVL+HPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 187 EWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 226 >emb|CBI25732.3| unnamed protein product [Vitis vinifera] Length = 405 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E RSLVL+HPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 366 EWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 405 >emb|CBI18847.3| unnamed protein product [Vitis vinifera] Length = 184 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E RSLVL+HPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 145 EWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 184 >ref|XP_002532178.1| calcineurin B, putative [Ricinus communis] gi|223528146|gb|EEF30215.1| calcineurin B, putative [Ricinus communis] Length = 223 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E RSLVL+HPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 184 EWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 223 >gb|ABW06390.1| CBL3 [Gossypium hirsutum] gi|157955939|gb|ABW06393.1| CBL3 [Gossypium hirsutum] Length = 226 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E RSLVL+HPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 187 EWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 226 >gb|ABW06389.1| CBL2 [Gossypium hirsutum] Length = 226 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 ERRSLVLQHPSLLKNMTLQYLKDITTTFPSFVFYSQVDDT 120 E RSLVL+HPSLLKNMTLQYLKDITTTFPSFVF+SQVDDT Sbjct: 187 EWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 226