BLASTX nr result
ID: Sinomenium22_contig00014961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00014961 (561 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529722.1| taxilin, putative [Ricinus communis] gi|2235... 68 1e-09 ref|XP_007009776.1| Uncharacterized protein isoform 1 [Theobroma... 68 2e-09 ref|XP_004307405.1| PREDICTED: alpha-taxilin-like [Fragaria vesc... 67 2e-09 ref|XP_007217970.1| hypothetical protein PRUPE_ppa005338mg [Prun... 67 3e-09 ref|XP_007217969.1| hypothetical protein PRUPE_ppa005338mg [Prun... 67 3e-09 ref|XP_006485895.1| PREDICTED: beta-taxilin-like isoform X2 [Cit... 66 7e-09 ref|XP_006436264.1| hypothetical protein CICLE_v10031457mg [Citr... 66 7e-09 ref|XP_006436263.1| hypothetical protein CICLE_v10031457mg [Citr... 66 7e-09 gb|EXB80109.1| hypothetical protein L484_013436 [Morus notabilis] 65 2e-08 ref|XP_003555431.1| PREDICTED: beta-taxilin-like [Glycine max] 64 2e-08 ref|XP_002276892.1| PREDICTED: alpha-taxilin [Vitis vinifera] gi... 64 3e-08 ref|XP_002316353.1| hypothetical protein POPTR_0010s22640g [Popu... 64 3e-08 ref|XP_007143680.1| hypothetical protein PHAVU_007G092600g [Phas... 63 5e-08 ref|XP_004143804.1| PREDICTED: alpha-taxilin-like [Cucumis sativ... 62 8e-08 ref|XP_006354837.1| PREDICTED: beta-taxilin-like isoform X2 [Sol... 62 1e-07 ref|XP_006354836.1| PREDICTED: beta-taxilin-like isoform X1 [Sol... 62 1e-07 gb|EYU39593.1| hypothetical protein MIMGU_mgv1a008191mg [Mimulus... 62 1e-07 ref|XP_003591958.1| Beta-taxilin [Medicago truncatula] gi|355481... 61 2e-07 gb|ABR18057.1| unknown [Picea sitchensis] 61 2e-07 ref|XP_004237557.1| PREDICTED: alpha-taxilin-like [Solanum lycop... 59 7e-07 >ref|XP_002529722.1| taxilin, putative [Ricinus communis] gi|223530824|gb|EEF32688.1| taxilin, putative [Ricinus communis] Length = 454 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNSFSGNS 116 RE LKKQLEKTKNQKEKLESLCRSLQAERKQNS GN+ Sbjct: 409 RERLKKQLEKTKNQKEKLESLCRSLQAERKQNSNGGNT 446 >ref|XP_007009776.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508726689|gb|EOY18586.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 434 Score = 67.8 bits (164), Expect = 2e-09 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNSFSGNS 116 RE LKKQLEKTKNQKEKLESLCRSLQAERKQ+S GNS Sbjct: 391 RERLKKQLEKTKNQKEKLESLCRSLQAERKQSSTGGNS 428 >ref|XP_004307405.1| PREDICTED: alpha-taxilin-like [Fragaria vesca subsp. vesca] Length = 463 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNSFSGNS 116 RE LKKQLEKTKNQKEKLESLCRSLQAERKQNS NS Sbjct: 420 RERLKKQLEKTKNQKEKLESLCRSLQAERKQNSSESNS 457 >ref|XP_007217970.1| hypothetical protein PRUPE_ppa005338mg [Prunus persica] gi|462414432|gb|EMJ19169.1| hypothetical protein PRUPE_ppa005338mg [Prunus persica] Length = 466 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNSFSGNS 116 RE LKKQLEKTKNQKEKLESLCRSLQAERKQNS N+ Sbjct: 423 RERLKKQLEKTKNQKEKLESLCRSLQAERKQNSIGSNN 460 >ref|XP_007217969.1| hypothetical protein PRUPE_ppa005338mg [Prunus persica] gi|462414431|gb|EMJ19168.1| hypothetical protein PRUPE_ppa005338mg [Prunus persica] Length = 441 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNSFSGNS 116 RE LKKQLEKTKNQKEKLESLCRSLQAERKQNS N+ Sbjct: 398 RERLKKQLEKTKNQKEKLESLCRSLQAERKQNSIGSNN 435 >ref|XP_006485895.1| PREDICTED: beta-taxilin-like isoform X2 [Citrus sinensis] Length = 438 Score = 65.9 bits (159), Expect = 7e-09 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNSFSGNSVSIGPK 134 RE +KKQLEK+KNQKEKLESLCRSLQAERKQNS N+ P+ Sbjct: 395 RERMKKQLEKSKNQKEKLESLCRSLQAERKQNSVGSNNSDSAPE 438 >ref|XP_006436264.1| hypothetical protein CICLE_v10031457mg [Citrus clementina] gi|568865045|ref|XP_006485894.1| PREDICTED: beta-taxilin-like isoform X1 [Citrus sinensis] gi|557538460|gb|ESR49504.1| hypothetical protein CICLE_v10031457mg [Citrus clementina] Length = 463 Score = 65.9 bits (159), Expect = 7e-09 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNSFSGNSVSIGPK 134 RE +KKQLEK+KNQKEKLESLCRSLQAERKQNS N+ P+ Sbjct: 420 RERMKKQLEKSKNQKEKLESLCRSLQAERKQNSVGSNNSDSAPE 463 >ref|XP_006436263.1| hypothetical protein CICLE_v10031457mg [Citrus clementina] gi|568865049|ref|XP_006485896.1| PREDICTED: beta-taxilin-like isoform X3 [Citrus sinensis] gi|557538459|gb|ESR49503.1| hypothetical protein CICLE_v10031457mg [Citrus clementina] Length = 434 Score = 65.9 bits (159), Expect = 7e-09 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNSFSGNSVSIGPK 134 RE +KKQLEK+KNQKEKLESLCRSLQAERKQNS N+ P+ Sbjct: 391 RERMKKQLEKSKNQKEKLESLCRSLQAERKQNSVGSNNSDSAPE 434 >gb|EXB80109.1| hypothetical protein L484_013436 [Morus notabilis] Length = 468 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNSFSGNS 116 RE LKKQLEKTK QKEKLESLCRSLQAERKQNS N+ Sbjct: 425 RERLKKQLEKTKKQKEKLESLCRSLQAERKQNSIGSNN 462 >ref|XP_003555431.1| PREDICTED: beta-taxilin-like [Glycine max] Length = 436 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNSFSGNS 116 RE +KKQLEKTKNQKEKLESLCRSLQAERKQNS S Sbjct: 393 RERMKKQLEKTKNQKEKLESLCRSLQAERKQNSSENKS 430 >ref|XP_002276892.1| PREDICTED: alpha-taxilin [Vitis vinifera] gi|296086051|emb|CBI31492.3| unnamed protein product [Vitis vinifera] Length = 418 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNSFSGNS 116 RE LKKQLEK KNQKEKLESLCRSLQAER+QNS N+ Sbjct: 379 RERLKKQLEKMKNQKEKLESLCRSLQAERRQNSIGSNA 416 >ref|XP_002316353.1| hypothetical protein POPTR_0010s22640g [Populus trichocarpa] gi|222865393|gb|EEF02524.1| hypothetical protein POPTR_0010s22640g [Populus trichocarpa] Length = 461 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNSFSGNS 116 RE LKKQL+KT+NQKEKLESLCRSLQAERKQN NS Sbjct: 418 REKLKKQLDKTRNQKEKLESLCRSLQAERKQNKTGSNS 455 >ref|XP_007143680.1| hypothetical protein PHAVU_007G092600g [Phaseolus vulgaris] gi|561016870|gb|ESW15674.1| hypothetical protein PHAVU_007G092600g [Phaseolus vulgaris] Length = 436 Score = 63.2 bits (152), Expect = 5e-08 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNSFSGNS 116 RE LKKQLEKTKNQKEKLESLCRSLQAERKQ+S S Sbjct: 393 RERLKKQLEKTKNQKEKLESLCRSLQAERKQSSSENKS 430 >ref|XP_004143804.1| PREDICTED: alpha-taxilin-like [Cucumis sativus] gi|449485922|ref|XP_004157311.1| PREDICTED: alpha-taxilin-like [Cucumis sativus] Length = 457 Score = 62.4 bits (150), Expect = 8e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNSFSGNS 116 RE LKKQLEKTK QKEKLESLCRSLQAERKQ+S N+ Sbjct: 414 REGLKKQLEKTKKQKEKLESLCRSLQAERKQSSMGSNT 451 >ref|XP_006354837.1| PREDICTED: beta-taxilin-like isoform X2 [Solanum tuberosum] Length = 362 Score = 62.0 bits (149), Expect = 1e-07 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNSF-SGNSVSI 125 RE+LKKQLEKT+NQKEKLE+LCRSLQAERK +S S NS S+ Sbjct: 319 REFLKKQLEKTRNQKEKLEALCRSLQAERKAHSIASSNSDSV 360 >ref|XP_006354836.1| PREDICTED: beta-taxilin-like isoform X1 [Solanum tuberosum] Length = 363 Score = 62.0 bits (149), Expect = 1e-07 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNSF-SGNSVSI 125 RE+LKKQLEKT+NQKEKLE+LCRSLQAERK +S S NS S+ Sbjct: 320 REFLKKQLEKTRNQKEKLEALCRSLQAERKAHSIASSNSDSV 361 >gb|EYU39593.1| hypothetical protein MIMGU_mgv1a008191mg [Mimulus guttatus] Length = 382 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNSFSGNS 116 RE LKKQLEKT+NQKEKLESLCRSLQAERK + GNS Sbjct: 338 RERLKKQLEKTRNQKEKLESLCRSLQAERKTITSGGNS 375 >ref|XP_003591958.1| Beta-taxilin [Medicago truncatula] gi|355481006|gb|AES62209.1| Beta-taxilin [Medicago truncatula] Length = 426 Score = 61.2 bits (147), Expect = 2e-07 Identities = 34/46 (73%), Positives = 36/46 (78%), Gaps = 3/46 (6%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQ---NSFSGNSVSIGP 131 RE LKKQLEKTKNQKEKLESLCRSLQAERKQ + S NS + P Sbjct: 380 RERLKKQLEKTKNQKEKLESLCRSLQAERKQILSENKSNNSSNSAP 425 >gb|ABR18057.1| unknown [Picea sitchensis] Length = 528 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNS 101 RE +KKQLEKTKNQKEKLESLCRSLQAERKQ S Sbjct: 472 REKVKKQLEKTKNQKEKLESLCRSLQAERKQQS 504 >ref|XP_004237557.1| PREDICTED: alpha-taxilin-like [Solanum lycopersicum] Length = 368 Score = 59.3 bits (142), Expect = 7e-07 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +3 Query: 3 REYLKKQLEKTKNQKEKLESLCRSLQAERKQNSF-SGNSVSI 125 RE+LKKQLEKT+NQKEKLE+LCR LQAERK S S NS S+ Sbjct: 325 REFLKKQLEKTRNQKEKLEALCRLLQAERKAQSLASSNSNSV 366