BLASTX nr result
ID: Sinomenium22_contig00014848
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00014848 (1269 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006469522.1| PREDICTED: probable serine/threonine-protein... 120 1e-24 ref|XP_006469521.1| PREDICTED: probable serine/threonine-protein... 120 1e-24 ref|XP_006447742.1| hypothetical protein CICLE_v10015796mg [Citr... 120 1e-24 ref|XP_003519617.2| PREDICTED: probable serine/threonine-protein... 119 4e-24 ref|XP_003544713.1| PREDICTED: probable serine/threonine-protein... 119 4e-24 gb|EXB67431.1| putative serine/threonine-protein kinase WNK11 [M... 118 5e-24 ref|XP_003553016.2| PREDICTED: probable serine/threonine-protein... 118 5e-24 ref|XP_006452512.1| hypothetical protein CICLE_v10009052mg [Citr... 118 5e-24 ref|XP_003600253.1| MAP kinase-like protein [Medicago truncatula... 118 5e-24 ref|XP_003617691.1| MAP kinase-like protein [Medicago truncatula... 117 8e-24 ref|XP_007211708.1| hypothetical protein PRUPE_ppa009318mg [Prun... 117 1e-23 ref|XP_003530782.2| PREDICTED: probable serine/threonine-protein... 117 1e-23 ref|XP_007146590.1| hypothetical protein PHAVU_006G053100g [Phas... 117 1e-23 ref|XP_006591734.1| PREDICTED: probable serine/threonine-protein... 115 3e-23 ref|XP_006346163.1| PREDICTED: probable serine/threonine-protein... 115 3e-23 ref|XP_004506675.1| PREDICTED: probable serine/threonine-protein... 115 4e-23 ref|XP_003600252.1| MAP kinase-like protein [Medicago truncatula... 115 4e-23 ref|XP_002276368.1| PREDICTED: probable serine/threonine-protein... 115 5e-23 ref|XP_007142505.1| hypothetical protein PHAVU_008G286300g [Phas... 114 9e-23 ref|XP_004491472.1| PREDICTED: probable serine/threonine-protein... 114 9e-23 >ref|XP_006469522.1| PREDICTED: probable serine/threonine-protein kinase WNK11-like isoform X2 [Citrus sinensis] Length = 289 Score = 120 bits (301), Expect = 1e-24 Identities = 54/67 (80%), Positives = 65/67 (97%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 +LE+VT+EIPYSECDS+AKIYKKVT GV+PQA+NK+KDPEV+ FIEKC+A+PRARPSASE Sbjct: 211 LLEMVTMEIPYSECDSVAKIYKKVTGGVKPQALNKVKDPEVKAFIEKCIAQPRARPSASE 270 Query: 1087 LLRDPFF 1067 LL+DPFF Sbjct: 271 LLKDPFF 277 >ref|XP_006469521.1| PREDICTED: probable serine/threonine-protein kinase WNK11-like isoform X1 [Citrus sinensis] Length = 296 Score = 120 bits (301), Expect = 1e-24 Identities = 54/67 (80%), Positives = 65/67 (97%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 +LE+VT+EIPYSECDS+AKIYKKVT GV+PQA+NK+KDPEV+ FIEKC+A+PRARPSASE Sbjct: 218 LLEMVTMEIPYSECDSVAKIYKKVTGGVKPQALNKVKDPEVKAFIEKCIAQPRARPSASE 277 Query: 1087 LLRDPFF 1067 LL+DPFF Sbjct: 278 LLKDPFF 284 >ref|XP_006447742.1| hypothetical protein CICLE_v10015796mg [Citrus clementina] gi|557550353|gb|ESR60982.1| hypothetical protein CICLE_v10015796mg [Citrus clementina] Length = 348 Score = 120 bits (301), Expect = 1e-24 Identities = 54/67 (80%), Positives = 65/67 (97%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 +LE+VT+EIPYSECDS+AKIYKKVT GV+PQA+NK+KDPEV+ FIEKC+A+PRARPSASE Sbjct: 270 LLEMVTMEIPYSECDSVAKIYKKVTGGVKPQALNKVKDPEVKAFIEKCIAQPRARPSASE 329 Query: 1087 LLRDPFF 1067 LL+DPFF Sbjct: 330 LLKDPFF 336 >ref|XP_003519617.2| PREDICTED: probable serine/threonine-protein kinase WNK11-like [Glycine max] Length = 300 Score = 119 bits (297), Expect = 4e-24 Identities = 54/67 (80%), Positives = 64/67 (95%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 VLE+VT+EIPYSECD++AKIYKKV+ GVRP A+NK+KDPEV+ FIEKCLA+PRARPSA+E Sbjct: 216 VLEMVTVEIPYSECDNVAKIYKKVSSGVRPAALNKVKDPEVKAFIEKCLAQPRARPSAAE 275 Query: 1087 LLRDPFF 1067 LLRDPFF Sbjct: 276 LLRDPFF 282 >ref|XP_003544713.1| PREDICTED: probable serine/threonine-protein kinase WNK11-like [Glycine max] Length = 299 Score = 119 bits (297), Expect = 4e-24 Identities = 54/67 (80%), Positives = 64/67 (95%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 VLE+VT+EIPYSECD++AKIYKKV+ GVRP A+NK+KDPEV+ FIEKCLA+PRARPSA+E Sbjct: 216 VLEMVTVEIPYSECDNVAKIYKKVSSGVRPAALNKVKDPEVKAFIEKCLAQPRARPSAAE 275 Query: 1087 LLRDPFF 1067 LLRDPFF Sbjct: 276 LLRDPFF 282 >gb|EXB67431.1| putative serine/threonine-protein kinase WNK11 [Morus notabilis] Length = 301 Score = 118 bits (296), Expect = 5e-24 Identities = 53/67 (79%), Positives = 64/67 (95%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 VLE+VTLEIPYSECD++AKIYKKVT GVRP A++K++DPEVR F+EKCLA+PRARPSA+E Sbjct: 217 VLEMVTLEIPYSECDNVAKIYKKVTSGVRPHALSKVRDPEVRAFVEKCLAQPRARPSATE 276 Query: 1087 LLRDPFF 1067 LL+DPFF Sbjct: 277 LLKDPFF 283 >ref|XP_003553016.2| PREDICTED: probable serine/threonine-protein kinase WNK11-like [Glycine max] Length = 299 Score = 118 bits (296), Expect = 5e-24 Identities = 55/67 (82%), Positives = 64/67 (95%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 VLE+VTLEIPYSECDS+AKIYKKV+ GVRPQA+NKIKD EV+ FIE+CLA+PRARPSA+E Sbjct: 219 VLEMVTLEIPYSECDSVAKIYKKVSSGVRPQALNKIKDAEVKAFIERCLAQPRARPSAAE 278 Query: 1087 LLRDPFF 1067 LL+DPFF Sbjct: 279 LLKDPFF 285 >ref|XP_006452512.1| hypothetical protein CICLE_v10009052mg [Citrus clementina] gi|568842018|ref|XP_006474950.1| PREDICTED: probable serine/threonine-protein kinase WNK11-like [Citrus sinensis] gi|557555738|gb|ESR65752.1| hypothetical protein CICLE_v10009052mg [Citrus clementina] Length = 296 Score = 118 bits (296), Expect = 5e-24 Identities = 54/67 (80%), Positives = 64/67 (95%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 VLE+VTLEIPYSECD++AKIYKKV+ G RP A+NKIKDPEV+EFIE+CLA+PRARPSA+E Sbjct: 219 VLEMVTLEIPYSECDNVAKIYKKVSSGQRPDALNKIKDPEVKEFIERCLAQPRARPSAAE 278 Query: 1087 LLRDPFF 1067 LL+DPFF Sbjct: 279 LLKDPFF 285 >ref|XP_003600253.1| MAP kinase-like protein [Medicago truncatula] gi|355489301|gb|AES70504.1| MAP kinase-like protein [Medicago truncatula] Length = 279 Score = 118 bits (296), Expect = 5e-24 Identities = 55/67 (82%), Positives = 63/67 (94%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 VLE+VTLEIPYSECD++AKIYKKVT GVRPQ++NKIKD EV+ FIEKCLA+PRARPSA E Sbjct: 200 VLEMVTLEIPYSECDNVAKIYKKVTSGVRPQSLNKIKDAEVKTFIEKCLAQPRARPSAEE 259 Query: 1087 LLRDPFF 1067 LL+DPFF Sbjct: 260 LLKDPFF 266 >ref|XP_003617691.1| MAP kinase-like protein [Medicago truncatula] gi|355519026|gb|AET00650.1| MAP kinase-like protein [Medicago truncatula] Length = 305 Score = 117 bits (294), Expect = 8e-24 Identities = 53/67 (79%), Positives = 64/67 (95%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 VLE+VTLEIPYSECD++AKIYKKV+ G+RP AMNK+KD EV+EFIE+CLA+PRARPSA+E Sbjct: 219 VLEMVTLEIPYSECDNVAKIYKKVSSGIRPAAMNKVKDSEVKEFIERCLAQPRARPSAAE 278 Query: 1087 LLRDPFF 1067 LL+DPFF Sbjct: 279 LLKDPFF 285 >ref|XP_007211708.1| hypothetical protein PRUPE_ppa009318mg [Prunus persica] gi|462407573|gb|EMJ12907.1| hypothetical protein PRUPE_ppa009318mg [Prunus persica] Length = 297 Score = 117 bits (293), Expect = 1e-23 Identities = 52/67 (77%), Positives = 63/67 (94%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 VLE+VTLEIPYSECD++ KIYKKVT GVRPQ++NK++DPEV+ F+EKCLA+PRARPSA+E Sbjct: 217 VLEMVTLEIPYSECDNVVKIYKKVTSGVRPQSLNKVEDPEVKAFVEKCLAQPRARPSATE 276 Query: 1087 LLRDPFF 1067 LL DPFF Sbjct: 277 LLNDPFF 283 >ref|XP_003530782.2| PREDICTED: probable serine/threonine-protein kinase WNK11-like [Glycine max] Length = 299 Score = 117 bits (292), Expect = 1e-23 Identities = 53/67 (79%), Positives = 64/67 (95%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 VLE+VTLEIPY+ECDS+AKIYKKV+ GVRPQA+NKIKD EV+ F+E+CLA+PRARPSA+E Sbjct: 219 VLEMVTLEIPYNECDSVAKIYKKVSSGVRPQALNKIKDAEVKAFVERCLAQPRARPSAAE 278 Query: 1087 LLRDPFF 1067 LL+DPFF Sbjct: 279 LLKDPFF 285 >ref|XP_007146590.1| hypothetical protein PHAVU_006G053100g [Phaseolus vulgaris] gi|561019813|gb|ESW18584.1| hypothetical protein PHAVU_006G053100g [Phaseolus vulgaris] Length = 299 Score = 117 bits (292), Expect = 1e-23 Identities = 53/67 (79%), Positives = 65/67 (97%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 VLE+VTLEIPYSECD++AKIYKKV+ GVRP+A++KI+DPEV+ FIEKCLA+PRARPSA+E Sbjct: 219 VLEIVTLEIPYSECDNVAKIYKKVSSGVRPEALSKIQDPEVKAFIEKCLAQPRARPSAAE 278 Query: 1087 LLRDPFF 1067 LL+DPFF Sbjct: 279 LLKDPFF 285 >ref|XP_006591734.1| PREDICTED: probable serine/threonine-protein kinase WNK11-like [Glycine max] Length = 107 Score = 115 bits (289), Expect = 3e-23 Identities = 53/67 (79%), Positives = 63/67 (94%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 VLELVT+EIPYSECD++ KIYKKV+ GVRP A+NK+KDP+V+ FIEKCLA+PRARPSA+E Sbjct: 23 VLELVTVEIPYSECDNVDKIYKKVSSGVRPTALNKVKDPKVKAFIEKCLAQPRARPSAAE 82 Query: 1087 LLRDPFF 1067 LLRDPFF Sbjct: 83 LLRDPFF 89 >ref|XP_006346163.1| PREDICTED: probable serine/threonine-protein kinase WNK11-like [Solanum tuberosum] Length = 306 Score = 115 bits (289), Expect = 3e-23 Identities = 52/67 (77%), Positives = 63/67 (94%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 VLE+VTLE+PYSECD++ KIYKKV GVRP+AM+K+KDPEV++FIEKCLA+PR RPSASE Sbjct: 218 VLEMVTLELPYSECDNVVKIYKKVISGVRPKAMDKVKDPEVKKFIEKCLAQPRVRPSASE 277 Query: 1087 LLRDPFF 1067 LL+DPFF Sbjct: 278 LLQDPFF 284 >ref|XP_004506675.1| PREDICTED: probable serine/threonine-protein kinase WNK11-like [Cicer arietinum] Length = 302 Score = 115 bits (288), Expect = 4e-23 Identities = 52/67 (77%), Positives = 63/67 (94%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 VLE+VTLEIPY+ECD++ KIYKKV+ GVRPQ+++KIKDPEV+ FIEKCLA+PRARPSA E Sbjct: 219 VLEMVTLEIPYNECDNVVKIYKKVSSGVRPQSLDKIKDPEVKAFIEKCLAQPRARPSAKE 278 Query: 1087 LLRDPFF 1067 LL+DPFF Sbjct: 279 LLKDPFF 285 >ref|XP_003600252.1| MAP kinase-like protein [Medicago truncatula] gi|355489300|gb|AES70503.1| MAP kinase-like protein [Medicago truncatula] Length = 340 Score = 115 bits (288), Expect = 4e-23 Identities = 54/67 (80%), Positives = 62/67 (92%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 VLE+VTLEIPYSECD++AKIYKKVT GVRPQ++NKIKD EV+ FIEKCLA+ RARPSA E Sbjct: 261 VLEMVTLEIPYSECDNVAKIYKKVTSGVRPQSLNKIKDAEVKTFIEKCLAQSRARPSAEE 320 Query: 1087 LLRDPFF 1067 LL+DPFF Sbjct: 321 LLKDPFF 327 >ref|XP_002276368.1| PREDICTED: probable serine/threonine-protein kinase WNK11 [Vitis vinifera] gi|297737533|emb|CBI26734.3| unnamed protein product [Vitis vinifera] Length = 297 Score = 115 bits (287), Expect = 5e-23 Identities = 53/66 (80%), Positives = 61/66 (92%) Frame = -3 Query: 1264 LELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASEL 1085 LE+VTLEIPYSECD+IAKIYKKV G RP+AM+K++DPEV+ FIEKCLA+PRARPSASEL Sbjct: 219 LEMVTLEIPYSECDNIAKIYKKVISGARPRAMDKVRDPEVKAFIEKCLAKPRARPSASEL 278 Query: 1084 LRDPFF 1067 L DPFF Sbjct: 279 LNDPFF 284 >ref|XP_007142505.1| hypothetical protein PHAVU_008G286300g [Phaseolus vulgaris] gi|561015638|gb|ESW14499.1| hypothetical protein PHAVU_008G286300g [Phaseolus vulgaris] Length = 297 Score = 114 bits (285), Expect = 9e-23 Identities = 49/67 (73%), Positives = 65/67 (97%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 +LE+VT+EIPYSECDS+AKIYKKVT G++PQA++K+ +PEV+EFIEKC+A+PRARPSA++ Sbjct: 218 LLEMVTMEIPYSECDSVAKIYKKVTKGIKPQALSKVTEPEVKEFIEKCIAQPRARPSATD 277 Query: 1087 LLRDPFF 1067 LL+DPFF Sbjct: 278 LLKDPFF 284 >ref|XP_004491472.1| PREDICTED: probable serine/threonine-protein kinase WNK11-like isoform X2 [Cicer arietinum] Length = 303 Score = 114 bits (285), Expect = 9e-23 Identities = 52/67 (77%), Positives = 62/67 (92%) Frame = -3 Query: 1267 VLELVTLEIPYSECDSIAKIYKKVTCGVRPQAMNKIKDPEVREFIEKCLARPRARPSASE 1088 VLE+VTLEIPYSECD++AKIYKKV+ G+RP A+NK+KD EV+ FIEKCLA+PRARPSA E Sbjct: 218 VLEMVTLEIPYSECDNVAKIYKKVSSGLRPAALNKVKDSEVKAFIEKCLAQPRARPSADE 277 Query: 1087 LLRDPFF 1067 LL+DPFF Sbjct: 278 LLKDPFF 284