BLASTX nr result
ID: Sinomenium22_contig00014599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00014599 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR32184.1| peptide transporter [Hakea actites] 56 6e-06 >gb|ABR32184.1| peptide transporter [Hakea actites] Length = 567 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = -1 Query: 122 CGDIENNKTSCPTSSVQLVFFFTALYLVAIAQGWHKPCIQ 3 CG+I TSC Q++FFF++LYLVA+AQG HKPC+Q Sbjct: 128 CGNINTISTSCHPPLYQIIFFFSSLYLVALAQGGHKPCVQ 167