BLASTX nr result
ID: Sinomenium22_contig00014522
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00014522 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002304233.2| hypothetical protein POPTR_0003s06730g [Popu... 60 2e-07 >ref|XP_002304233.2| hypothetical protein POPTR_0003s06730g [Populus trichocarpa] gi|550342574|gb|EEE79212.2| hypothetical protein POPTR_0003s06730g [Populus trichocarpa] Length = 515 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/76 (40%), Positives = 41/76 (53%), Gaps = 1/76 (1%) Frame = +1 Query: 55 VTSLPKAGGRIQ-QQGEYYVQGRYHYGESCKYQPEYTEYCMGSSKTWRPMTQKLCRYYVQ 231 + S + GG Q Q Y+ QGR HYG +CK+ E E +LCRY+ Q Sbjct: 418 IRSPHRQGGDQQIQLCRYFAQGRCHYGHNCKFVHESRE-------------GQLCRYFAQ 464 Query: 232 GRCHYGDSCKFLHERK 279 GRC+YG CKF+HE + Sbjct: 465 GRCYYGHDCKFVHESR 480