BLASTX nr result
ID: Sinomenium22_contig00013948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00013948 (487 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007136042.1| hypothetical protein PHAVU_009G013100g [Phas... 57 2e-06 >ref|XP_007136042.1| hypothetical protein PHAVU_009G013100g [Phaseolus vulgaris] gi|561009129|gb|ESW08036.1| hypothetical protein PHAVU_009G013100g [Phaseolus vulgaris] Length = 215 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 487 LIQQTTLVRQCLQPELGKDGPPPFSLKAFLKS 392 LIQQTT+VRQCL E GKDGPPPFSLK FLKS Sbjct: 184 LIQQTTVVRQCLSQEPGKDGPPPFSLKDFLKS 215