BLASTX nr result
ID: Sinomenium22_contig00013899
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00013899 (470 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004252197.1| PREDICTED: rhodanese-like domain-containing ... 81 2e-13 ref|XP_006345730.1| PREDICTED: rhodanese-like domain-containing ... 79 5e-13 gb|EYU17793.1| hypothetical protein MIMGU_mgv1a006537mg [Mimulus... 71 1e-10 ref|XP_002264379.2| PREDICTED: UPF0176 protein pc0378-like [Viti... 67 3e-09 ref|XP_006374262.1| hypothetical protein POPTR_0015s05490g [Popu... 66 6e-09 ref|XP_006847929.1| hypothetical protein AMTR_s00029p00123460 [A... 66 6e-09 ref|XP_004159612.1| PREDICTED: rhodanese-like domain-containing ... 63 5e-08 ref|XP_004136802.1| PREDICTED: rhodanese-like domain-containing ... 63 5e-08 ref|XP_007037152.1| Rhodanese/Cell cycle control phosphatase sup... 62 6e-08 ref|XP_007037151.1| Rhodanese/Cell cycle control phosphatase sup... 62 6e-08 ref|XP_004980951.1| PREDICTED: rhodanese-like domain-containing ... 62 1e-07 ref|XP_004299477.1| PREDICTED: rhodanese-like domain-containing ... 62 1e-07 ref|XP_004503237.1| PREDICTED: rhodanese-like domain-containing ... 61 2e-07 ref|XP_006303538.1| hypothetical protein CARUB_v10010974mg [Caps... 61 2e-07 ref|XP_002463459.1| hypothetical protein SORBIDRAFT_01g000270 [S... 60 3e-07 gb|EEC76591.1| hypothetical protein OsI_14442 [Oryza sativa Indi... 60 3e-07 ref|NP_001051982.1| Os03g0861700 [Oryza sativa Japonica Group] g... 60 3e-07 gb|AAP44745.1| unknown protein [Oryza sativa Japonica Group] 60 3e-07 gb|AAF97265.1|AC034106_8 Contains a Rhodanese-like PF|00581 doma... 59 5e-07 ref|NP_001185025.1| rhodanese homology domain-containing protein... 59 5e-07 >ref|XP_004252197.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic-like [Solanum lycopersicum] Length = 420 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = +1 Query: 328 PDEKEGKESFIVVNFYCFVFIEDPEEQVSKHLSFLQGRDIRGRIYLN 468 P E E +E FIVVNFY FVFIEDPEE+VSKHLSFL+GRDI GRIYLN Sbjct: 62 PKEVENEEEFIVVNFYRFVFIEDPEEEVSKHLSFLEGRDIHGRIYLN 108 >ref|XP_006345730.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 420 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = +1 Query: 328 PDEKEGKESFIVVNFYCFVFIEDPEEQVSKHLSFLQGRDIRGRIYLN 468 P E + +E FIVVNFY FVFIEDPEE+VSKHLSFL+GRDI GRIYLN Sbjct: 62 PKEIDNEEEFIVVNFYRFVFIEDPEEEVSKHLSFLEGRDIHGRIYLN 108 >gb|EYU17793.1| hypothetical protein MIMGU_mgv1a006537mg [Mimulus guttatus] Length = 440 Score = 71.2 bits (173), Expect = 1e-10 Identities = 39/68 (57%), Positives = 47/68 (69%) Frame = +1 Query: 265 SSSFGGYSNEEEYEFLKAAACPDEKEGKESFIVVNFYCFVFIEDPEEQVSKHLSFLQGRD 444 SSS GG+ + A P E E E FIVVNFY FVF+++PEE+V +HLSF+QGRD Sbjct: 63 SSSTGGWIDV-------VAGAPKEYEDAE-FIVVNFYRFVFVQNPEEEVLRHLSFMQGRD 114 Query: 445 IRGRIYLN 468 I GRIYLN Sbjct: 115 IHGRIYLN 122 >ref|XP_002264379.2| PREDICTED: UPF0176 protein pc0378-like [Vitis vinifera] Length = 441 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/49 (65%), Positives = 36/49 (73%) Frame = +1 Query: 322 ACPDEKEGKESFIVVNFYCFVFIEDPEEQVSKHLSFLQGRDIRGRIYLN 468 A E FIVVNFY FVFI+DPE +VSKHLSFLQG DI GR+Y+N Sbjct: 74 AVSSELSNDGGFIVVNFYRFVFIQDPELEVSKHLSFLQGFDIHGRVYIN 122 >ref|XP_006374262.1| hypothetical protein POPTR_0015s05490g [Populus trichocarpa] gi|550322019|gb|ERP52059.1| hypothetical protein POPTR_0015s05490g [Populus trichocarpa] Length = 460 Score = 65.9 bits (159), Expect = 6e-09 Identities = 38/82 (46%), Positives = 44/82 (53%) Frame = +1 Query: 223 LWKQDFLQCRVFPVSSSFGGYSNEEEYEFLKAAACPDEKEGKESFIVVNFYCFVFIEDPE 402 LWK C P SS+ SN+ FIVVNFY FVFI DP Sbjct: 69 LWK---FNCATIPSSSTVANPSND--------------------FIVVNFYRFVFINDPH 105 Query: 403 EQVSKHLSFLQGRDIRGRIYLN 468 E+V+KHLSFL+G DI GRIY+N Sbjct: 106 EEVAKHLSFLKGLDIHGRIYVN 127 >ref|XP_006847929.1| hypothetical protein AMTR_s00029p00123460 [Amborella trichopoda] gi|548851234|gb|ERN09510.1| hypothetical protein AMTR_s00029p00123460 [Amborella trichopoda] Length = 465 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = +1 Query: 313 KAAACPDEKEGKESFIVVNFYCFVFIEDPEEQVSKHLSFLQGRDIRGRIYLN 468 +A+A EK E FIVVNFY FV IE+PEE+V++H FLQGRDI+GRIYLN Sbjct: 88 EASALRSEKA--EGFIVVNFYRFVCIENPEEEVTRHRLFLQGRDIQGRIYLN 137 >ref|XP_004159612.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic-like [Cucumis sativus] Length = 431 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +1 Query: 346 KESFIVVNFYCFVFIEDPEEQVSKHLSFLQGRDIRGRIYLN 468 +E F+VVNFY FVFIEDP+ +VSKHL F++ DI GRIYLN Sbjct: 83 EEDFVVVNFYHFVFIEDPQAEVSKHLYFMRDLDIHGRIYLN 123 >ref|XP_004136802.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic-like [Cucumis sativus] Length = 431 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +1 Query: 346 KESFIVVNFYCFVFIEDPEEQVSKHLSFLQGRDIRGRIYLN 468 +E F+VVNFY FVFIEDP+ +VSKHL F++ DI GRIYLN Sbjct: 83 EEDFVVVNFYHFVFIEDPQAEVSKHLYFMRDLDIHGRIYLN 123 >ref|XP_007037152.1| Rhodanese/Cell cycle control phosphatase superfamily protein isoform 2 [Theobroma cacao] gi|508774397|gb|EOY21653.1| Rhodanese/Cell cycle control phosphatase superfamily protein isoform 2 [Theobroma cacao] Length = 431 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/40 (65%), Positives = 36/40 (90%) Frame = +1 Query: 349 ESFIVVNFYCFVFIEDPEEQVSKHLSFLQGRDIRGRIYLN 468 E+F+VVNFY FVFI+DP+ +V+KHL+FL+G +I GRIY+N Sbjct: 79 ENFVVVNFYRFVFIKDPQHEVAKHLTFLKGLNIHGRIYIN 118 >ref|XP_007037151.1| Rhodanese/Cell cycle control phosphatase superfamily protein isoform 1 [Theobroma cacao] gi|508774396|gb|EOY21652.1| Rhodanese/Cell cycle control phosphatase superfamily protein isoform 1 [Theobroma cacao] Length = 498 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/40 (65%), Positives = 36/40 (90%) Frame = +1 Query: 349 ESFIVVNFYCFVFIEDPEEQVSKHLSFLQGRDIRGRIYLN 468 E+F+VVNFY FVFI+DP+ +V+KHL+FL+G +I GRIY+N Sbjct: 79 ENFVVVNFYRFVFIKDPQHEVAKHLTFLKGLNIHGRIYIN 118 >ref|XP_004980951.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic-like [Setaria italica] Length = 439 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 2/49 (4%) Frame = +1 Query: 328 PDEKEGKES--FIVVNFYCFVFIEDPEEQVSKHLSFLQGRDIRGRIYLN 468 PDE+E + F+VV FY FV +EDP +V+ HL FLQGRDI GRIYLN Sbjct: 60 PDEEEEDDDARFVVVTFYKFVPLEDPRAEVASHLHFLQGRDIHGRIYLN 108 >ref|XP_004299477.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 446 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = +1 Query: 325 CPDEKEGKES--FIVVNFYCFVFIEDPEEQVSKHLSFLQGRDIRGRIYLN 468 C E E +E ++VVNFY FV IED E +V+KHL FL+G DIRGRIY+N Sbjct: 79 CESENERREDNEWVVVNFYQFVMIEDAEGEVAKHLRFLEGLDIRGRIYVN 128 >ref|XP_004503237.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic-like isoform X1 [Cicer arietinum] gi|502137950|ref|XP_004503238.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic-like isoform X2 [Cicer arietinum] Length = 442 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/40 (70%), Positives = 35/40 (87%), Gaps = 2/40 (5%) Frame = +1 Query: 355 FIVVNFYCFVFIEDPEEQVSKHLSF--LQGRDIRGRIYLN 468 F+VVNFY FVFI+DP+E+V+KHLSF L+G DI GR+YLN Sbjct: 70 FVVVNFYHFVFIKDPQEEVAKHLSFLELEGLDIHGRVYLN 109 >ref|XP_006303538.1| hypothetical protein CARUB_v10010974mg [Capsella rubella] gi|482572249|gb|EOA36436.1| hypothetical protein CARUB_v10010974mg [Capsella rubella] Length = 436 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = +1 Query: 334 EKEGKESFIVVNFYCFVFIEDPEEQVSKHLSFLQGRDIRGRIYLN 468 + EG E FIVVNFY FV IEDPE ++ KH SFL+ +IRGRIYLN Sbjct: 76 DNEG-EDFIVVNFYRFVSIEDPEAEIDKHFSFLKDLNIRGRIYLN 119 >ref|XP_002463459.1| hypothetical protein SORBIDRAFT_01g000270 [Sorghum bicolor] gi|241917313|gb|EER90457.1| hypothetical protein SORBIDRAFT_01g000270 [Sorghum bicolor] Length = 414 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 3/50 (6%) Frame = +1 Query: 328 PDEKEGKES---FIVVNFYCFVFIEDPEEQVSKHLSFLQGRDIRGRIYLN 468 P+E+E + F+VV FY FV +EDP +V +HL+FLQGRDI GRIYLN Sbjct: 60 PEEEEDGDDDARFVVVTFYKFVPLEDPHAEVVRHLNFLQGRDIHGRIYLN 109 >gb|EEC76591.1| hypothetical protein OsI_14442 [Oryza sativa Indica Group] Length = 426 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 349 ESFIVVNFYCFVFIEDPEEQVSKHLSFLQGRDIRGRIYLN 468 + F+VV FY FV I+DP +VS+HL FLQGRDI GRIY+N Sbjct: 58 QEFVVVTFYKFVSIDDPRAEVSRHLHFLQGRDIHGRIYMN 97 >ref|NP_001051982.1| Os03g0861700 [Oryza sativa Japonica Group] gi|108712235|gb|ABG00030.1| Rhodanese-like domain containing protein, expressed [Oryza sativa Japonica Group] gi|113550453|dbj|BAF13896.1| Os03g0861700 [Oryza sativa Japonica Group] gi|215694644|dbj|BAG89835.1| unnamed protein product [Oryza sativa Japonica Group] Length = 405 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 349 ESFIVVNFYCFVFIEDPEEQVSKHLSFLQGRDIRGRIYLN 468 + F+VV FY FV I+DP +VS+HL FLQGRDI GRIY+N Sbjct: 58 QEFVVVTFYKFVSIDDPRAEVSRHLHFLQGRDIHGRIYMN 97 >gb|AAP44745.1| unknown protein [Oryza sativa Japonica Group] Length = 463 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 349 ESFIVVNFYCFVFIEDPEEQVSKHLSFLQGRDIRGRIYLN 468 + F+VV FY FV I+DP +VS+HL FLQGRDI GRIY+N Sbjct: 58 QEFVVVTFYKFVSIDDPRAEVSRHLHFLQGRDIHGRIYMN 97 >gb|AAF97265.1|AC034106_8 Contains a Rhodanese-like PF|00581 domain. ESTs gb|T45773, gb|AA394520 come from this gene [Arabidopsis thaliana] Length = 423 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +1 Query: 349 ESFIVVNFYCFVFIEDPEEQVSKHLSFLQGRDIRGRIYLN 468 E FIVVNFY FV I DPE ++ KHLSFL+ +IRGRIYLN Sbjct: 81 EDFIVVNFYRFVSIGDPEAEIEKHLSFLKDLNIRGRIYLN 120 >ref|NP_001185025.1| rhodanese homology domain-containing protein [Arabidopsis thaliana] gi|384950757|sp|F4I933.1|STR8_ARATH RecName: Full=Rhodanese-like domain-containing protein 8, chloroplastic; AltName: Full=Sulfurtransferase 8; Short=AtStr8; Flags: Precursor gi|332191523|gb|AEE29644.1| rhodanese homology domain-containing protein [Arabidopsis thaliana] Length = 448 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +1 Query: 349 ESFIVVNFYCFVFIEDPEEQVSKHLSFLQGRDIRGRIYLN 468 E FIVVNFY FV I DPE ++ KHLSFL+ +IRGRIYLN Sbjct: 81 EDFIVVNFYRFVSIGDPEAEIEKHLSFLKDLNIRGRIYLN 120