BLASTX nr result
ID: Sinomenium22_contig00013679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00013679 (611 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007138539.1| hypothetical protein PHAVU_009G217600g [Phas... 84 3e-14 ref|XP_003568083.1| PREDICTED: periodic tryptophan protein 2-lik... 83 5e-14 ref|XP_003546561.1| PREDICTED: periodic tryptophan protein 2-lik... 83 7e-14 ref|XP_003533831.1| PREDICTED: periodic tryptophan protein 2 [Gl... 83 7e-14 ref|XP_004961476.1| PREDICTED: periodic tryptophan protein 2 hom... 82 9e-14 ref|XP_006654657.1| PREDICTED: periodic tryptophan protein 2-lik... 82 2e-13 ref|XP_002304160.2| hypothetical protein POPTR_0003s05930g [Popu... 82 2e-13 gb|EMS59459.1| Periodic tryptophan protein 2 [Triticum urartu] 81 3e-13 dbj|BAK07937.1| predicted protein [Hordeum vulgare subsp. vulgare] 81 3e-13 gb|EXB33240.1| Periodic tryptophan protein 2-like protein [Morus... 80 5e-13 gb|AFW78845.1| hypothetical protein ZEAMMB73_852154 [Zea mays] 80 6e-13 ref|XP_002441396.1| hypothetical protein SORBIDRAFT_09g025880 [S... 80 6e-13 ref|XP_002517579.1| WD-repeat protein, putative [Ricinus communi... 80 6e-13 ref|NP_001130414.1| uncharacterized protein LOC100191510 [Zea ma... 80 6e-13 ref|XP_002299610.2| transducin family protein [Populus trichocar... 79 8e-13 ref|XP_006341673.1| PREDICTED: periodic tryptophan protein 2 hom... 79 1e-12 ref|XP_004488269.1| PREDICTED: periodic tryptophan protein 2-lik... 79 1e-12 ref|XP_004235716.1| PREDICTED: periodic tryptophan protein 2 hom... 79 1e-12 ref|XP_006465380.1| PREDICTED: periodic tryptophan protein 2 hom... 79 1e-12 ref|XP_006427191.1| hypothetical protein CICLE_v10024861mg [Citr... 79 1e-12 >ref|XP_007138539.1| hypothetical protein PHAVU_009G217600g [Phaseolus vulgaris] gi|561011626|gb|ESW10533.1| hypothetical protein PHAVU_009G217600g [Phaseolus vulgaris] Length = 886 Score = 84.0 bits (206), Expect = 3e-14 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -2 Query: 607 SIQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSAGSK 467 SIQQNSR+LLP+L+SLQKAITK+HQDLADTCS NEY LRYLCS+G+K Sbjct: 839 SIQQNSRNLLPSLKSLQKAITKIHQDLADTCSSNEYMLRYLCSSGTK 885 >ref|XP_003568083.1| PREDICTED: periodic tryptophan protein 2-like [Brachypodium distachyon] Length = 881 Score = 83.2 bits (204), Expect = 5e-14 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -2 Query: 604 IQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSAGSKS 464 IQQNSR+LLPAL+SLQK+ITKLHQDLADTCS NEY L+YLCSAG+K+ Sbjct: 835 IQQNSRALLPALKSLQKSITKLHQDLADTCSSNEYLLKYLCSAGTKN 881 >ref|XP_003546561.1| PREDICTED: periodic tryptophan protein 2-like [Glycine max] Length = 898 Score = 82.8 bits (203), Expect = 7e-14 Identities = 38/47 (80%), Positives = 45/47 (95%) Frame = -2 Query: 607 SIQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSAGSK 467 SIQQNSR+LLP+L+SLQKAIT++HQDLADTCS NEY LRYLCS+G+K Sbjct: 851 SIQQNSRNLLPSLKSLQKAITRIHQDLADTCSSNEYMLRYLCSSGAK 897 >ref|XP_003533831.1| PREDICTED: periodic tryptophan protein 2 [Glycine max] Length = 904 Score = 82.8 bits (203), Expect = 7e-14 Identities = 38/47 (80%), Positives = 45/47 (95%) Frame = -2 Query: 607 SIQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSAGSK 467 SIQQNSR+LLP+L+SLQKAIT++HQDLADTCS NEY LRYLCS+G+K Sbjct: 857 SIQQNSRNLLPSLKSLQKAITRIHQDLADTCSSNEYMLRYLCSSGAK 903 >ref|XP_004961476.1| PREDICTED: periodic tryptophan protein 2 homolog [Setaria italica] Length = 884 Score = 82.4 bits (202), Expect = 9e-14 Identities = 38/47 (80%), Positives = 45/47 (95%) Frame = -2 Query: 604 IQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSAGSKS 464 IQQNSR+LLPAL+SLQK+IT+LHQD+ADTCS NEY LRYLCSAG+K+ Sbjct: 838 IQQNSRTLLPALKSLQKSITRLHQDMADTCSSNEYLLRYLCSAGTKN 884 >ref|XP_006654657.1| PREDICTED: periodic tryptophan protein 2-like [Oryza brachyantha] Length = 888 Score = 81.6 bits (200), Expect = 2e-13 Identities = 36/48 (75%), Positives = 46/48 (95%) Frame = -2 Query: 607 SIQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSAGSKS 464 +IQQNSR+LLPAL+SLQK++T++HQDLADTCS NEY L+YLCSAG+K+ Sbjct: 841 NIQQNSRALLPALKSLQKSVTRIHQDLADTCSSNEYMLKYLCSAGTKN 888 >ref|XP_002304160.2| hypothetical protein POPTR_0003s05930g [Populus trichocarpa] gi|550342505|gb|EEE79139.2| hypothetical protein POPTR_0003s05930g [Populus trichocarpa] Length = 497 Score = 81.6 bits (200), Expect = 2e-13 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = -2 Query: 607 SIQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSAGSK 467 SIQQNSR+LLPAL+SLQKAIT++HQDLADTCS NEY LRYLCS+ +K Sbjct: 451 SIQQNSRNLLPALKSLQKAITRIHQDLADTCSSNEYMLRYLCSSNNK 497 >gb|EMS59459.1| Periodic tryptophan protein 2 [Triticum urartu] Length = 817 Score = 80.9 bits (198), Expect = 3e-13 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = -2 Query: 604 IQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSAGSKS 464 IQQNSR+LLPAL+SLQK+ITKLHQDLADTCS NEY L+YL SAG+KS Sbjct: 771 IQQNSRTLLPALKSLQKSITKLHQDLADTCSSNEYMLKYLSSAGTKS 817 >dbj|BAK07937.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 876 Score = 80.9 bits (198), Expect = 3e-13 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = -2 Query: 604 IQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSAGSKS 464 IQQNSR+LLPAL+SLQK+ITKLHQDLADTCS NEY L+YL SAG+KS Sbjct: 830 IQQNSRTLLPALKSLQKSITKLHQDLADTCSSNEYMLKYLSSAGTKS 876 >gb|EXB33240.1| Periodic tryptophan protein 2-like protein [Morus notabilis] Length = 895 Score = 80.1 bits (196), Expect = 5e-13 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -2 Query: 607 SIQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSAGSK 467 SIQQNSR+LLP+L+SL+KAIT++HQDLADTCS NEY LRYLCS SK Sbjct: 848 SIQQNSRNLLPSLKSLEKAITRIHQDLADTCSSNEYMLRYLCSTSSK 894 >gb|AFW78845.1| hypothetical protein ZEAMMB73_852154 [Zea mays] Length = 885 Score = 79.7 bits (195), Expect = 6e-13 Identities = 36/47 (76%), Positives = 45/47 (95%) Frame = -2 Query: 604 IQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSAGSKS 464 IQQNSR+LLP+L+SLQK+IT+LHQDLADTCS NEY L+YLC+AG+K+ Sbjct: 839 IQQNSRTLLPSLKSLQKSITRLHQDLADTCSSNEYLLKYLCTAGTKN 885 >ref|XP_002441396.1| hypothetical protein SORBIDRAFT_09g025880 [Sorghum bicolor] gi|241946681|gb|EES19826.1| hypothetical protein SORBIDRAFT_09g025880 [Sorghum bicolor] Length = 883 Score = 79.7 bits (195), Expect = 6e-13 Identities = 36/47 (76%), Positives = 45/47 (95%) Frame = -2 Query: 604 IQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSAGSKS 464 IQQNSR+LLP+L+SLQK+IT+LHQDLADTCS NEY L+YLC+AG+K+ Sbjct: 837 IQQNSRTLLPSLKSLQKSITRLHQDLADTCSSNEYLLKYLCTAGTKN 883 >ref|XP_002517579.1| WD-repeat protein, putative [Ricinus communis] gi|223543211|gb|EEF44743.1| WD-repeat protein, putative [Ricinus communis] Length = 895 Score = 79.7 bits (195), Expect = 6e-13 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -2 Query: 607 SIQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSAGS 470 SIQQNSR+LLP+L+SLQKAIT++HQDLADTCS NEY LRYLC+A S Sbjct: 848 SIQQNSRNLLPSLKSLQKAITRIHQDLADTCSSNEYMLRYLCTASS 893 >ref|NP_001130414.1| uncharacterized protein LOC100191510 [Zea mays] gi|194689058|gb|ACF78613.1| unknown [Zea mays] Length = 461 Score = 79.7 bits (195), Expect = 6e-13 Identities = 36/47 (76%), Positives = 45/47 (95%) Frame = -2 Query: 604 IQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSAGSKS 464 IQQNSR+LLP+L+SLQK+IT+LHQDLADTCS NEY L+YLC+AG+K+ Sbjct: 415 IQQNSRTLLPSLKSLQKSITRLHQDLADTCSSNEYLLKYLCTAGTKN 461 >ref|XP_002299610.2| transducin family protein [Populus trichocarpa] gi|550347536|gb|EEE84415.2| transducin family protein [Populus trichocarpa] Length = 893 Score = 79.3 bits (194), Expect = 8e-13 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = -2 Query: 607 SIQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSAGSK 467 SIQQNSR+LLPAL+SLQKAIT +HQDLADTCS NEY LRYLCS+ +K Sbjct: 846 SIQQNSRNLLPALKSLQKAITGIHQDLADTCSSNEYMLRYLCSSTNK 892 >ref|XP_006341673.1| PREDICTED: periodic tryptophan protein 2 homolog isoform X1 [Solanum tuberosum] gi|565349386|ref|XP_006341674.1| PREDICTED: periodic tryptophan protein 2 homolog isoform X2 [Solanum tuberosum] gi|565349388|ref|XP_006341675.1| PREDICTED: periodic tryptophan protein 2 homolog isoform X3 [Solanum tuberosum] Length = 892 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 607 SIQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSA 476 SIQQ SRSLLPAL+SLQKAIT+LHQDLADTC+ NEY LRYLCSA Sbjct: 845 SIQQKSRSLLPALKSLQKAITRLHQDLADTCNSNEYMLRYLCSA 888 >ref|XP_004488269.1| PREDICTED: periodic tryptophan protein 2-like [Cicer arietinum] Length = 884 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = -2 Query: 607 SIQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSAGS 470 SIQQNSR+LLP+L+SLQK+IT +HQDLADTCS NEY LRYLCS+G+ Sbjct: 837 SIQQNSRNLLPSLKSLQKSITSIHQDLADTCSSNEYMLRYLCSSGA 882 >ref|XP_004235716.1| PREDICTED: periodic tryptophan protein 2 homolog [Solanum lycopersicum] Length = 892 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 607 SIQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSA 476 SIQQ SRSLLPAL+SLQKAIT+LHQDLADTC+ NEY LRYLCSA Sbjct: 845 SIQQKSRSLLPALKSLQKAITRLHQDLADTCNSNEYMLRYLCSA 888 >ref|XP_006465380.1| PREDICTED: periodic tryptophan protein 2 homolog [Citrus sinensis] Length = 884 Score = 78.6 bits (192), Expect = 1e-12 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = -2 Query: 607 SIQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSAGSK 467 +IQQNSR+LLP+L+SLQK+IT++HQDLADTCS NEY L+YLCS G+K Sbjct: 837 TIQQNSRNLLPSLKSLQKSITRIHQDLADTCSSNEYMLQYLCSVGAK 883 >ref|XP_006427191.1| hypothetical protein CICLE_v10024861mg [Citrus clementina] gi|557529181|gb|ESR40431.1| hypothetical protein CICLE_v10024861mg [Citrus clementina] Length = 884 Score = 78.6 bits (192), Expect = 1e-12 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = -2 Query: 607 SIQQNSRSLLPALRSLQKAITKLHQDLADTCSFNEYSLRYLCSAGSK 467 +IQQNSR+LLP+L+SLQK+IT++HQDLADTCS NEY L+YLCS G+K Sbjct: 837 TIQQNSRNLLPSLKSLQKSITRIHQDLADTCSSNEYMLQYLCSVGAK 883