BLASTX nr result
ID: Sinomenium22_contig00013575
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00013575 (487 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006364585.1| PREDICTED: uncharacterized endoplasmic retic... 57 2e-06 ref|XP_004236030.1| PREDICTED: uncharacterized endoplasmic retic... 57 2e-06 ref|XP_004236029.1| PREDICTED: uncharacterized endoplasmic retic... 57 2e-06 ref|XP_002316127.2| hypothetical protein POPTR_0010s17380g [Popu... 57 3e-06 ref|XP_002311311.1| hypothetical protein POPTR_0008s08830g [Popu... 56 6e-06 >ref|XP_006364585.1| PREDICTED: uncharacterized endoplasmic reticulum membrane protein C16E8.02-like [Solanum tuberosum] Length = 196 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 3 QMLFGYEPYPGFHARVRAKVDAEIKNWQAKK 95 Q LFGYEPYPGFH++V+A +DAEIK WQ KK Sbjct: 161 QSLFGYEPYPGFHSKVKATIDAEIKEWQEKK 191 >ref|XP_004236030.1| PREDICTED: uncharacterized endoplasmic reticulum membrane protein C16E8.02-like isoform 2 [Solanum lycopersicum] Length = 175 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 3 QMLFGYEPYPGFHARVRAKVDAEIKNWQAKK 95 Q LFGYEPYPGFH++V+A +DAEIK WQ KK Sbjct: 140 QSLFGYEPYPGFHSKVKATIDAEIKEWQEKK 170 >ref|XP_004236029.1| PREDICTED: uncharacterized endoplasmic reticulum membrane protein C16E8.02-like isoform 1 [Solanum lycopersicum] Length = 196 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 3 QMLFGYEPYPGFHARVRAKVDAEIKNWQAKK 95 Q LFGYEPYPGFH++V+A +DAEIK WQ KK Sbjct: 161 QSLFGYEPYPGFHSKVKATIDAEIKEWQEKK 191 >ref|XP_002316127.2| hypothetical protein POPTR_0010s17380g [Populus trichocarpa] gi|118485204|gb|ABK94463.1| unknown [Populus trichocarpa] gi|550330009|gb|EEF02298.2| hypothetical protein POPTR_0010s17380g [Populus trichocarpa] Length = 203 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 3 QMLFGYEPYPGFHARVRAKVDAEIKNWQAKKL 98 Q FGYEPYPGFHA V+AK+DAEIK W+ KKL Sbjct: 168 QTSFGYEPYPGFHASVQAKIDAEIKEWKEKKL 199 >ref|XP_002311311.1| hypothetical protein POPTR_0008s08830g [Populus trichocarpa] gi|222851131|gb|EEE88678.1| hypothetical protein POPTR_0008s08830g [Populus trichocarpa] Length = 202 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +3 Query: 3 QMLFGYEPYPGFHARVRAKVDAEIKNWQAKKL 98 Q FGYEPYPGFHA V+A++DAEIK W+ KKL Sbjct: 167 QTSFGYEPYPGFHASVQARIDAEIKEWREKKL 198