BLASTX nr result
ID: Sinomenium22_contig00013469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00013469 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307540.1| hypothetical protein POPTR_0005s22290g [Popu... 57 2e-06 ref|XP_002300885.2| hypothetical protein POPTR_0002s06140g [Popu... 56 6e-06 >ref|XP_002307540.1| hypothetical protein POPTR_0005s22290g [Populus trichocarpa] gi|222856989|gb|EEE94536.1| hypothetical protein POPTR_0005s22290g [Populus trichocarpa] Length = 225 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 314 VRKLEASLVNYWHKKGLKPTSHSLLSEAKECVKVPP 207 VRKLE SL+NYW K+G+KP SH+LL +A ECVK PP Sbjct: 188 VRKLEMSLMNYWLKRGMKPISHNLLPDAMECVKDPP 223 >ref|XP_002300885.2| hypothetical protein POPTR_0002s06140g [Populus trichocarpa] gi|550344385|gb|EEE80158.2| hypothetical protein POPTR_0002s06140g [Populus trichocarpa] Length = 355 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -3 Query: 314 VRKLEASLVNYWHKKGLKPTSHSLLSEAKECVKVPP 207 VRKLE SL+ YW K+GLKP SH+LL +A +CVK PP Sbjct: 318 VRKLETSLMGYWFKRGLKPISHNLLPDAMQCVKDPP 353