BLASTX nr result
ID: Sinomenium22_contig00013016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00013016 (869 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAE99290.1| beta-N-acetylhexosaminidase -like protein [Arabi... 57 7e-06 ref|XP_006403480.1| hypothetical protein EUTSA_v10010264mg [Eutr... 57 9e-06 >dbj|BAE99290.1| beta-N-acetylhexosaminidase -like protein [Arabidopsis thaliana] Length = 541 Score = 57.4 bits (137), Expect = 7e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 97 RLQERNMTAKDGYKYFVLRAQEIAISKSWTPV 2 RLQ RN T KD YKYFVLRAQ+IAISK+WTPV Sbjct: 347 RLQGRNFTTKDAYKYFVLRAQQIAISKNWTPV 378 >ref|XP_006403480.1| hypothetical protein EUTSA_v10010264mg [Eutrema salsugineum] gi|557104599|gb|ESQ44933.1| hypothetical protein EUTSA_v10010264mg [Eutrema salsugineum] Length = 547 Score = 57.0 bits (136), Expect = 9e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 94 LQERNMTAKDGYKYFVLRAQEIAISKSWTPV 2 LQ+RN T KD YKYFVLRAQ+IAISK+WTPV Sbjct: 354 LQDRNFTTKDAYKYFVLRAQQIAISKNWTPV 384