BLASTX nr result
ID: Sinomenium22_contig00012209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00012209 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24863.1| hypothetical protein MIMGU_mgv1a005316mg [Mimulus... 64 2e-08 ref|XP_006365995.1| PREDICTED: diacylglycerol kinase 5-like isof... 64 2e-08 ref|XP_006365994.1| PREDICTED: diacylglycerol kinase 5-like isof... 64 2e-08 ref|XP_006365993.1| PREDICTED: diacylglycerol kinase 5-like isof... 64 2e-08 ref|XP_007149903.1| hypothetical protein PHAVU_005G108700g [Phas... 64 2e-08 ref|XP_002319931.2| hypothetical protein POPTR_0013s14470g [Popu... 64 2e-08 ref|XP_004248144.1| PREDICTED: diacylglycerol kinase iota-like [... 64 2e-08 ref|XP_003540337.1| PREDICTED: diacylglycerol kinase 5-like isof... 63 4e-08 gb|AHW50676.1| diacylglycerol kinase [Nicotiana tabacum] 62 1e-07 gb|EYU26096.1| hypothetical protein MIMGU_mgv1a005244mg [Mimulus... 62 1e-07 ref|XP_006357549.1| PREDICTED: diacylglycerol kinase 5-like isof... 62 1e-07 ref|XP_006357548.1| PREDICTED: diacylglycerol kinase 5-like isof... 62 1e-07 ref|XP_006357547.1| PREDICTED: diacylglycerol kinase 5-like isof... 62 1e-07 gb|AAG23130.1| diacylglycerol kinase variant A [Solanum lycopers... 62 1e-07 gb|AAG23129.1|AF198259_1 diacylglycerol kinase [Solanum lycopers... 62 1e-07 gb|AAG23131.1| diacylglycerol kinase variant B [Solanum lycopers... 62 1e-07 ref|NP_001234476.1| calmodulin-binding diacylglycerol kinase [So... 62 1e-07 gb|AFK41745.1| unknown [Medicago truncatula] 61 1e-07 ref|XP_006841856.1| hypothetical protein AMTR_s00003p00271270 [A... 61 2e-07 gb|EXB62315.1| Diacylglycerol kinase iota [Morus notabilis] 60 2e-07 >gb|EYU24863.1| hypothetical protein MIMGU_mgv1a005316mg [Mimulus guttatus] Length = 489 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRRD 1 SIRSIVCLNLPSFSGGLNPWGTPN N RRD Sbjct: 314 SIRSIVCLNLPSFSGGLNPWGTPNSNKRRD 343 >ref|XP_006365995.1| PREDICTED: diacylglycerol kinase 5-like isoform X3 [Solanum tuberosum] gi|565400983|ref|XP_006365996.1| PREDICTED: diacylglycerol kinase 5-like isoform X4 [Solanum tuberosum] Length = 493 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRRD 1 SIRSIVCLNLPSFSGGLNPWGTPN N RRD Sbjct: 317 SIRSIVCLNLPSFSGGLNPWGTPNSNKRRD 346 >ref|XP_006365994.1| PREDICTED: diacylglycerol kinase 5-like isoform X2 [Solanum tuberosum] Length = 500 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRRD 1 SIRSIVCLNLPSFSGGLNPWGTPN N RRD Sbjct: 324 SIRSIVCLNLPSFSGGLNPWGTPNSNKRRD 353 >ref|XP_006365993.1| PREDICTED: diacylglycerol kinase 5-like isoform X1 [Solanum tuberosum] Length = 502 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRRD 1 SIRSIVCLNLPSFSGGLNPWGTPN N RRD Sbjct: 326 SIRSIVCLNLPSFSGGLNPWGTPNSNKRRD 355 >ref|XP_007149903.1| hypothetical protein PHAVU_005G108700g [Phaseolus vulgaris] gi|561023167|gb|ESW21897.1| hypothetical protein PHAVU_005G108700g [Phaseolus vulgaris] Length = 423 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRRD 1 SIRSIVCLNLPSFSGGLNPWGTPNK+ RRD Sbjct: 315 SIRSIVCLNLPSFSGGLNPWGTPNKHKRRD 344 >ref|XP_002319931.2| hypothetical protein POPTR_0013s14470g [Populus trichocarpa] gi|550325844|gb|EEE95854.2| hypothetical protein POPTR_0013s14470g [Populus trichocarpa] Length = 493 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRRD 1 SIRSIVCLNLPSFSGGLNPWGTPN N RRD Sbjct: 318 SIRSIVCLNLPSFSGGLNPWGTPNSNKRRD 347 >ref|XP_004248144.1| PREDICTED: diacylglycerol kinase iota-like [Solanum lycopersicum] Length = 493 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRRD 1 SIRSIVCLNLPSFSGGLNPWGTPN N RRD Sbjct: 317 SIRSIVCLNLPSFSGGLNPWGTPNSNKRRD 346 >ref|XP_003540337.1| PREDICTED: diacylglycerol kinase 5-like isoform X1 [Glycine max] gi|571494383|ref|XP_006592834.1| PREDICTED: diacylglycerol kinase 5-like isoform X2 [Glycine max] Length = 488 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRRD 1 SIRSIVCLNLPSFSGGLNPWGTPNK RRD Sbjct: 314 SIRSIVCLNLPSFSGGLNPWGTPNKMKRRD 343 >gb|AHW50676.1| diacylglycerol kinase [Nicotiana tabacum] Length = 493 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRR 4 S+RSIVCLNLPSFSGGLNPWGTPN N RR Sbjct: 319 SVRSIVCLNLPSFSGGLNPWGTPNNNKRR 347 >gb|EYU26096.1| hypothetical protein MIMGU_mgv1a005244mg [Mimulus guttatus] Length = 492 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRR 4 SIRSIVCLNLPSFSGGLNPWGTPN N RR Sbjct: 318 SIRSIVCLNLPSFSGGLNPWGTPNTNRRR 346 >ref|XP_006357549.1| PREDICTED: diacylglycerol kinase 5-like isoform X3 [Solanum tuberosum] Length = 544 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRR 4 S+RSIVCLNLPSFSGGLNPWGTPN N RR Sbjct: 348 SVRSIVCLNLPSFSGGLNPWGTPNSNKRR 376 >ref|XP_006357548.1| PREDICTED: diacylglycerol kinase 5-like isoform X2 [Solanum tuberosum] Length = 489 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRR 4 S+RSIVCLNLPSFSGGLNPWGTPN N RR Sbjct: 315 SVRSIVCLNLPSFSGGLNPWGTPNSNKRR 343 >ref|XP_006357547.1| PREDICTED: diacylglycerol kinase 5-like isoform X1 [Solanum tuberosum] Length = 522 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRR 4 S+RSIVCLNLPSFSGGLNPWGTPN N RR Sbjct: 348 SVRSIVCLNLPSFSGGLNPWGTPNSNKRR 376 >gb|AAG23130.1| diacylglycerol kinase variant A [Solanum lycopersicum] Length = 489 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRR 4 S+RSIVCLNLPSFSGGLNPWGTPN N RR Sbjct: 315 SVRSIVCLNLPSFSGGLNPWGTPNSNKRR 343 >gb|AAG23129.1|AF198259_1 diacylglycerol kinase [Solanum lycopersicum] Length = 489 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRR 4 S+RSIVCLNLPSFSGGLNPWGTPN N RR Sbjct: 315 SVRSIVCLNLPSFSGGLNPWGTPNSNKRR 343 >gb|AAG23131.1| diacylglycerol kinase variant B [Solanum lycopersicum] Length = 511 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRR 4 S+RSIVCLNLPSFSGGLNPWGTPN N RR Sbjct: 315 SVRSIVCLNLPSFSGGLNPWGTPNSNKRR 343 >ref|NP_001234476.1| calmodulin-binding diacylglycerol kinase [Solanum lycopersicum] gi|10798890|gb|AAG23128.1|AF198258_1 calmodulin-binding diacylglycerol kinase [Solanum lycopersicum] Length = 511 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRR 4 S+RSIVCLNLPSFSGGLNPWGTPN N RR Sbjct: 315 SVRSIVCLNLPSFSGGLNPWGTPNSNKRR 343 >gb|AFK41745.1| unknown [Medicago truncatula] Length = 484 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRRD 1 SIRSIVCLNLPSFSGGLNPWGTPN+ +RD Sbjct: 312 SIRSIVCLNLPSFSGGLNPWGTPNRKKQRD 341 >ref|XP_006841856.1| hypothetical protein AMTR_s00003p00271270 [Amborella trichopoda] gi|548843877|gb|ERN03531.1| hypothetical protein AMTR_s00003p00271270 [Amborella trichopoda] Length = 489 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRRD 1 SIRSI+CLNLPSFSGGLNPWGTPNK ++D Sbjct: 312 SIRSIICLNLPSFSGGLNPWGTPNKKKKQD 341 >gb|EXB62315.1| Diacylglycerol kinase iota [Morus notabilis] Length = 487 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 90 SIRSIVCLNLPSFSGGLNPWGTPNKNNRRD 1 SIRSIVCLNLPSFSGGLNPWGTPN R+D Sbjct: 311 SIRSIVCLNLPSFSGGLNPWGTPNSRKRQD 340