BLASTX nr result
ID: Sinomenium22_contig00010974
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00010974 (481 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB93883.1| putative S-acyltransferase [Morus notabilis] 62 6e-08 ref|XP_007030747.1| DHHC-type zinc finger family protein isoform... 62 1e-07 ref|XP_007030746.1| DHHC-type zinc finger family protein isoform... 62 1e-07 ref|XP_002512306.1| zinc finger protein, putative [Ricinus commu... 61 2e-07 ref|XP_002266567.1| PREDICTED: probable S-acyltransferase At3g04... 61 2e-07 emb|CAN82653.1| hypothetical protein VITISV_038833 [Vitis vinifera] 61 2e-07 ref|XP_004244899.1| PREDICTED: probable S-acyltransferase At3g04... 57 3e-06 ref|XP_007205314.1| hypothetical protein PRUPE_ppa006849mg [Prun... 56 5e-06 ref|XP_004302473.1| PREDICTED: probable S-acyltransferase At3g04... 55 8e-06 >gb|EXB93883.1| putative S-acyltransferase [Morus notabilis] Length = 393 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +2 Query: 38 SFFQRSPLEDVEVVVVDNIYDKGVLNNLHEIVFPLSSRSS 157 SFF+RSPLED EVVV +N+YD+G L NL EI+FP SSRSS Sbjct: 345 SFFRRSPLEDAEVVVKNNVYDRGFLRNLCEIIFPFSSRSS 384 >ref|XP_007030747.1| DHHC-type zinc finger family protein isoform 2 [Theobroma cacao] gi|508719352|gb|EOY11249.1| DHHC-type zinc finger family protein isoform 2 [Theobroma cacao] Length = 341 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/46 (58%), Positives = 38/46 (82%) Frame = +2 Query: 38 SFFQRSPLEDVEVVVVDNIYDKGVLNNLHEIVFPLSSRSSNLGGKS 175 SFF+RSPLED E VV +N+YDKG +N++E++FP+S+R+S L KS Sbjct: 293 SFFRRSPLEDTEAVVRNNVYDKGFFHNIYEVIFPVSTRASLLWTKS 338 >ref|XP_007030746.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao] gi|508719351|gb|EOY11248.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao] Length = 393 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/46 (58%), Positives = 38/46 (82%) Frame = +2 Query: 38 SFFQRSPLEDVEVVVVDNIYDKGVLNNLHEIVFPLSSRSSNLGGKS 175 SFF+RSPLED E VV +N+YDKG +N++E++FP+S+R+S L KS Sbjct: 345 SFFRRSPLEDTEAVVRNNVYDKGFFHNIYEVIFPVSTRASLLWTKS 390 >ref|XP_002512306.1| zinc finger protein, putative [Ricinus communis] gi|223548267|gb|EEF49758.1| zinc finger protein, putative [Ricinus communis] Length = 393 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = +2 Query: 38 SFFQRSPLEDVEVVVVDNIYDKGVLNNLHEIVFPLSSRSSNLGGKS 175 +FF+RSPLE EVV+ N+YDKG+ NNL EI+FPLS+R S L KS Sbjct: 345 AFFRRSPLEGAEVVIKRNMYDKGIFNNLGEIIFPLSTRPSFLRKKS 390 >ref|XP_002266567.1| PREDICTED: probable S-acyltransferase At3g04970 [Vitis vinifera] gi|298205009|emb|CBI34316.3| unnamed protein product [Vitis vinifera] Length = 393 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = +2 Query: 38 SFFQRSPLEDVEVVVVDNIYDKGVLNNLHEIVFPLSSRSSNLGGKS 175 +FF+RS LEDVE V +NIYDKG L NLHEI+FPLSSR S KS Sbjct: 345 AFFRRSRLEDVEPVSKNNIYDKGFLRNLHEIIFPLSSRHSFSQAKS 390 >emb|CAN82653.1| hypothetical protein VITISV_038833 [Vitis vinifera] Length = 309 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = +2 Query: 38 SFFQRSPLEDVEVVVVDNIYDKGVLNNLHEIVFPLSSRSSNLGGKS 175 +FF+RS LEDVE V +NIYDKG L NLHEI+FPLSSR S KS Sbjct: 261 AFFRRSRLEDVEPVSKNNIYDKGFLRNLHEIIFPLSSRHSFSQAKS 306 >ref|XP_004244899.1| PREDICTED: probable S-acyltransferase At3g04970-like [Solanum lycopersicum] Length = 392 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +2 Query: 38 SFFQRSPLEDVEVVVVDNIYDKGVLNNLHEIVFPLSSRSSNLGGK 172 +FFQRSPLE+VEVV +NIYD+GVL N+ EIV PLSSR S L K Sbjct: 345 AFFQRSPLEEVEVVK-NNIYDRGVLQNVFEIVVPLSSRRSFLQRK 388 >ref|XP_007205314.1| hypothetical protein PRUPE_ppa006849mg [Prunus persica] gi|462400956|gb|EMJ06513.1| hypothetical protein PRUPE_ppa006849mg [Prunus persica] Length = 393 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = +2 Query: 38 SFFQRSPLEDVEVVVVDNIYDKGVLNNLHEIVFPLSSRSSNLGGKS 175 + F+RSPL+DVEVVV +NIYDKG N+ EI+ PLS R +L KS Sbjct: 345 AIFRRSPLKDVEVVVTNNIYDKGFFQNILEIIMPLSRRQLSLRTKS 390 >ref|XP_004302473.1| PREDICTED: probable S-acyltransferase At3g04970-like [Fragaria vesca subsp. vesca] Length = 393 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +2 Query: 38 SFFQRSPLEDVEVVVVDNIYDKGVLNNLHEIVFPLSSR 151 + F+RSPLEDVEVVV +NIYDKG N EI+FPLS R Sbjct: 345 TLFRRSPLEDVEVVVKNNIYDKGFFQNFLEIIFPLSRR 382