BLASTX nr result
ID: Sinomenium22_contig00010973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00010973 (620 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512306.1| zinc finger protein, putative [Ricinus commu... 62 1e-07 ref|XP_007030747.1| DHHC-type zinc finger family protein isoform... 62 2e-07 ref|XP_007030746.1| DHHC-type zinc finger family protein isoform... 62 2e-07 ref|XP_002266567.1| PREDICTED: probable S-acyltransferase At3g04... 60 4e-07 emb|CAN82653.1| hypothetical protein VITISV_038833 [Vitis vinifera] 60 4e-07 gb|EXB93883.1| putative S-acyltransferase [Morus notabilis] 60 7e-07 ref|XP_007205314.1| hypothetical protein PRUPE_ppa006849mg [Prun... 57 3e-06 ref|XP_004302473.1| PREDICTED: probable S-acyltransferase At3g04... 57 6e-06 >ref|XP_002512306.1| zinc finger protein, putative [Ricinus communis] gi|223548267|gb|EEF49758.1| zinc finger protein, putative [Ricinus communis] Length = 393 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +2 Query: 2 RSFFQRSTLEDVEVVVVDNIYDKGVFNNLHEIVFPLSSRSSNLGGKS 142 R+FF+RS LE EVV+ N+YDKG+FNNL EI+FPLS+R S L KS Sbjct: 344 RAFFRRSPLEGAEVVIKRNMYDKGIFNNLGEIIFPLSTRPSFLRKKS 390 >ref|XP_007030747.1| DHHC-type zinc finger family protein isoform 2 [Theobroma cacao] gi|508719352|gb|EOY11249.1| DHHC-type zinc finger family protein isoform 2 [Theobroma cacao] Length = 341 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/47 (57%), Positives = 39/47 (82%) Frame = +2 Query: 2 RSFFQRSTLEDVEVVVVDNIYDKGVFNNLHEIVFPLSSRSSNLGGKS 142 +SFF+RS LED E VV +N+YDKG F+N++E++FP+S+R+S L KS Sbjct: 292 KSFFRRSPLEDTEAVVRNNVYDKGFFHNIYEVIFPVSTRASLLWTKS 338 >ref|XP_007030746.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao] gi|508719351|gb|EOY11248.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao] Length = 393 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/47 (57%), Positives = 39/47 (82%) Frame = +2 Query: 2 RSFFQRSTLEDVEVVVVDNIYDKGVFNNLHEIVFPLSSRSSNLGGKS 142 +SFF+RS LED E VV +N+YDKG F+N++E++FP+S+R+S L KS Sbjct: 344 KSFFRRSPLEDTEAVVRNNVYDKGFFHNIYEVIFPVSTRASLLWTKS 390 >ref|XP_002266567.1| PREDICTED: probable S-acyltransferase At3g04970 [Vitis vinifera] gi|298205009|emb|CBI34316.3| unnamed protein product [Vitis vinifera] Length = 393 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = +2 Query: 2 RSFFQRSTLEDVEVVVVDNIYDKGVFNNLHEIVFPLSSRSSNLGGKS 142 ++FF+RS LEDVE V +NIYDKG NLHEI+FPLSSR S KS Sbjct: 344 KAFFRRSRLEDVEPVSKNNIYDKGFLRNLHEIIFPLSSRHSFSQAKS 390 >emb|CAN82653.1| hypothetical protein VITISV_038833 [Vitis vinifera] Length = 309 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = +2 Query: 2 RSFFQRSTLEDVEVVVVDNIYDKGVFNNLHEIVFPLSSRSSNLGGKS 142 ++FF+RS LEDVE V +NIYDKG NLHEI+FPLSSR S KS Sbjct: 260 KAFFRRSRLEDVEPVSKNNIYDKGFLRNLHEIIFPLSSRHSFSQAKS 306 >gb|EXB93883.1| putative S-acyltransferase [Morus notabilis] Length = 393 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +2 Query: 2 RSFFQRSTLEDVEVVVVDNIYDKGVFNNLHEIVFPLSSRSS 124 RSFF+RS LED EVVV +N+YD+G NL EI+FP SSRSS Sbjct: 344 RSFFRRSPLEDAEVVVKNNVYDRGFLRNLCEIIFPFSSRSS 384 >ref|XP_007205314.1| hypothetical protein PRUPE_ppa006849mg [Prunus persica] gi|462400956|gb|EMJ06513.1| hypothetical protein PRUPE_ppa006849mg [Prunus persica] Length = 393 Score = 57.4 bits (137), Expect = 3e-06 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = +2 Query: 2 RSFFQRSTLEDVEVVVVDNIYDKGVFNNLHEIVFPLSSRSSNLGGKS 142 R+ F+RS L+DVEVVV +NIYDKG F N+ EI+ PLS R +L KS Sbjct: 344 RAIFRRSPLKDVEVVVTNNIYDKGFFQNILEIIMPLSRRQLSLRTKS 390 >ref|XP_004302473.1| PREDICTED: probable S-acyltransferase At3g04970-like [Fragaria vesca subsp. vesca] Length = 393 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +2 Query: 2 RSFFQRSTLEDVEVVVVDNIYDKGVFNNLHEIVFPLSSR 118 R+ F+RS LEDVEVVV +NIYDKG F N EI+FPLS R Sbjct: 344 RTLFRRSPLEDVEVVVKNNIYDKGFFQNFLEIIFPLSRR 382