BLASTX nr result
ID: Sinomenium22_contig00010935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00010935 (449 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320319.2| hypothetical protein POPTR_0014s11930g [Popu... 56 6e-06 >ref|XP_002320319.2| hypothetical protein POPTR_0014s11930g [Populus trichocarpa] gi|550324029|gb|EEE98634.2| hypothetical protein POPTR_0014s11930g [Populus trichocarpa] Length = 411 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/50 (48%), Positives = 35/50 (70%) Frame = -3 Query: 447 LIFSDRGHCPRRSFKDWVLLILSHIMYSISVLLTFLANIFGKLGQIDNLK 298 L+ SDRGH P+++ +DW L +LS +M + L +FLA++ KLGQ D LK Sbjct: 361 LLISDRGHSPKKNLQDWALFVLSWLMCFMGALFSFLADLCSKLGQRDRLK 410