BLASTX nr result
ID: Sinomenium22_contig00010442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00010442 (1010 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007031564.1| Mitogen-activated protein kinase kinase 3 is... 67 1e-08 gb|EXC20335.1| Mitogen-activated protein kinase kinase 6 [Morus ... 64 8e-08 ref|XP_004304648.1| PREDICTED: mitogen-activated protein kinase ... 63 2e-07 ref|XP_006840856.1| hypothetical protein AMTR_s00083p00130670 [A... 63 2e-07 ref|XP_004158323.1| PREDICTED: mitogen-activated protein kinase ... 62 3e-07 gb|EPS68103.1| hypothetical protein M569_06666 [Genlisea aurea] 62 5e-07 ref|XP_004141107.1| PREDICTED: mitogen-activated protein kinase ... 61 8e-07 ref|XP_002521460.1| serine/threonine protein kinase, putative [R... 61 8e-07 gb|AET36532.1| MAPKK3 [Gossypium hirsutum] 60 1e-06 ref|XP_007215030.1| hypothetical protein PRUPE_ppa004289mg [Prun... 60 1e-06 ref|XP_002298538.1| hypothetical protein POPTR_0001s35290g [Popu... 60 1e-06 ref|XP_006446578.1| hypothetical protein CICLE_v10014932mg [Citr... 60 2e-06 ref|XP_002274862.1| PREDICTED: mitogen-activated protein kinase ... 60 2e-06 emb|CAN80150.1| hypothetical protein VITISV_035387 [Vitis vinifera] 60 2e-06 ref|XP_007151002.1| hypothetical protein PHAVU_004G010400g [Phas... 59 3e-06 dbj|BAA06731.1| NPK2 [Nicotiana tabacum] 59 3e-06 gb|ADT91697.1| serine/threonine protein kinase 2 [Nicotiana atte... 59 3e-06 ref|XP_003524547.1| PREDICTED: dual specificity mitogen-activate... 59 4e-06 ref|XP_006470256.1| PREDICTED: mitogen-activated protein kinase ... 58 7e-06 ref|XP_002960466.1| hypothetical protein SELMODRAFT_74697 [Selag... 58 7e-06 >ref|XP_007031564.1| Mitogen-activated protein kinase kinase 3 isoform 1 [Theobroma cacao] gi|508710593|gb|EOY02490.1| Mitogen-activated protein kinase kinase 3 isoform 1 [Theobroma cacao] Length = 518 Score = 67.0 bits (162), Expect = 1e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 MLTIHYYLLFDGPDE WHHT+ LYNEDSTF + Sbjct: 369 MLTIHYYLLFDGPDETWHHTRTLYNEDSTFSF 400 >gb|EXC20335.1| Mitogen-activated protein kinase kinase 6 [Morus notabilis] Length = 515 Score = 64.3 bits (155), Expect = 8e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 MLTIHYYLLFDGPDELW HTK LYNEDS F + Sbjct: 366 MLTIHYYLLFDGPDELWQHTKKLYNEDSIFSF 397 >ref|XP_004304648.1| PREDICTED: mitogen-activated protein kinase kinase 6-like [Fragaria vesca subsp. vesca] Length = 518 Score = 63.2 bits (152), Expect = 2e-07 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 MLTIHYYLLFDGPDELW H K LYNEDS F + Sbjct: 369 MLTIHYYLLFDGPDELWQHAKTLYNEDSVFSF 400 >ref|XP_006840856.1| hypothetical protein AMTR_s00083p00130670 [Amborella trichopoda] gi|548842709|gb|ERN02531.1| hypothetical protein AMTR_s00083p00130670 [Amborella trichopoda] Length = 517 Score = 62.8 bits (151), Expect = 2e-07 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 MLT+HYY+LFDGPDELWHH K +YN++STF + Sbjct: 368 MLTVHYYMLFDGPDELWHHIKTMYNDNSTFSF 399 >ref|XP_004158323.1| PREDICTED: mitogen-activated protein kinase kinase 6-like [Cucumis sativus] Length = 518 Score = 62.4 bits (150), Expect = 3e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 MLTIHYYLLFDGPD+ WHHTKALY+E ST + Sbjct: 369 MLTIHYYLLFDGPDDFWHHTKALYHESSTLSF 400 >gb|EPS68103.1| hypothetical protein M569_06666 [Genlisea aurea] Length = 512 Score = 61.6 bits (148), Expect = 5e-07 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 MLT+HYY LFDGPD LWHH K LY +DSTFR+ Sbjct: 369 MLTVHYYSLFDGPDNLWHHAKNLYQQDSTFRF 400 >ref|XP_004141107.1| PREDICTED: mitogen-activated protein kinase kinase 6-like [Cucumis sativus] Length = 518 Score = 60.8 bits (146), Expect = 8e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 MLTIHYYLLFDGPD+ WHHTKAL++E ST + Sbjct: 369 MLTIHYYLLFDGPDDFWHHTKALFHESSTLSF 400 >ref|XP_002521460.1| serine/threonine protein kinase, putative [Ricinus communis] gi|223539359|gb|EEF40950.1| serine/threonine protein kinase, putative [Ricinus communis] Length = 518 Score = 60.8 bits (146), Expect = 8e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 MLT+HYYLLFDGPDELW HTK LY E STF + Sbjct: 369 MLTMHYYLLFDGPDELWQHTKTLYKEGSTFSF 400 >gb|AET36532.1| MAPKK3 [Gossypium hirsutum] Length = 518 Score = 60.5 bits (145), Expect = 1e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 MLT+HYYLLFDGPDE W H + LYNEDSTF + Sbjct: 369 MLTLHYYLLFDGPDENWQHARTLYNEDSTFSF 400 >ref|XP_007215030.1| hypothetical protein PRUPE_ppa004289mg [Prunus persica] gi|462411180|gb|EMJ16229.1| hypothetical protein PRUPE_ppa004289mg [Prunus persica] Length = 518 Score = 60.5 bits (145), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 MLTIH+YLLFDGPDELW HT+ LY+EDS F + Sbjct: 369 MLTIHFYLLFDGPDELWQHTRTLYSEDSVFSF 400 >ref|XP_002298538.1| hypothetical protein POPTR_0001s35290g [Populus trichocarpa] gi|222845796|gb|EEE83343.1| hypothetical protein POPTR_0001s35290g [Populus trichocarpa] Length = 521 Score = 60.5 bits (145), Expect = 1e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 MLTIHYYLLFDGP+ELW HTKA YNE S F + Sbjct: 369 MLTIHYYLLFDGPEELWQHTKAFYNEGSIFSF 400 >ref|XP_006446578.1| hypothetical protein CICLE_v10014932mg [Citrus clementina] gi|557549189|gb|ESR59818.1| hypothetical protein CICLE_v10014932mg [Citrus clementina] Length = 518 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 ML IHYYLLFDGPDELW H K LYNE ST R+ Sbjct: 369 MLAIHYYLLFDGPDELWQHLKILYNEGSTLRF 400 >ref|XP_002274862.1| PREDICTED: mitogen-activated protein kinase kinase 6 [Vitis vinifera] gi|296087617|emb|CBI34873.3| unnamed protein product [Vitis vinifera] Length = 518 Score = 59.7 bits (143), Expect = 2e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 ML IHYYLLFDGPD+LW HTK LY +DSTF + Sbjct: 369 MLMIHYYLLFDGPDDLWQHTKTLYKKDSTFSF 400 >emb|CAN80150.1| hypothetical protein VITISV_035387 [Vitis vinifera] Length = 543 Score = 59.7 bits (143), Expect = 2e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 ML IHYYLLFDGPD+LW HTK LY +DSTF + Sbjct: 394 MLMIHYYLLFDGPDDLWQHTKTLYKKDSTFSF 425 >ref|XP_007151002.1| hypothetical protein PHAVU_004G010400g [Phaseolus vulgaris] gi|561024311|gb|ESW22996.1| hypothetical protein PHAVU_004G010400g [Phaseolus vulgaris] Length = 519 Score = 58.9 bits (141), Expect = 3e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 MLTIHYYLLFDGPD+LW HT+ LYNE S F + Sbjct: 370 MLTIHYYLLFDGPDDLWQHTRNLYNETSIFSF 401 >dbj|BAA06731.1| NPK2 [Nicotiana tabacum] Length = 518 Score = 58.9 bits (141), Expect = 3e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 MLTIHYYLLFDG DE W HTK LYNE STF + Sbjct: 369 MLTIHYYLLFDGSDEFWQHTKTLYNECSTFSF 400 >gb|ADT91697.1| serine/threonine protein kinase 2 [Nicotiana attenuata] Length = 518 Score = 58.9 bits (141), Expect = 3e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 MLTIHYYLLFDG DE W HTK LYNE STF + Sbjct: 369 MLTIHYYLLFDGSDEFWQHTKTLYNECSTFSF 400 >ref|XP_003524547.1| PREDICTED: dual specificity mitogen-activated protein kinase kinase 1-like [Glycine max] Length = 518 Score = 58.5 bits (140), Expect = 4e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 MLTIHYYLLFDGPD+LW HTK LY+E S F + Sbjct: 369 MLTIHYYLLFDGPDDLWQHTKNLYSESSIFSF 400 >ref|XP_006470256.1| PREDICTED: mitogen-activated protein kinase kinase 1-like [Citrus sinensis] Length = 518 Score = 57.8 bits (138), Expect = 7e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 ML IHYYLLFDGPDELW H K LY+E ST R+ Sbjct: 369 MLAIHYYLLFDGPDELWQHLKILYDEGSTLRF 400 >ref|XP_002960466.1| hypothetical protein SELMODRAFT_74697 [Selaginella moellendorffii] gi|300171405|gb|EFJ38005.1| hypothetical protein SELMODRAFT_74697 [Selaginella moellendorffii] Length = 509 Score = 57.8 bits (138), Expect = 7e-06 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = +3 Query: 723 MLTIHYYLLFDGPDELWHHTKALYNEDSTFRY 818 MLT+HYY+LFDGPD LWHH K Y ++STF + Sbjct: 362 MLTVHYYMLFDGPDSLWHHMKTFYRQNSTFSF 393