BLASTX nr result
ID: Sinomenium22_contig00009941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00009941 (460 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT33750.1| Putative chromatin-remodeling complex ATPase chai... 62 8e-08 >gb|EMT33750.1| Putative chromatin-remodeling complex ATPase chain [Aegilops tauschii] Length = 950 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -3 Query: 455 LLLCKVRLRTIDPKWSDPSPGPCIRGSFVHRAVLF 351 LL C+ RLRTIDPKWSDPSP PC GS++HRA LF Sbjct: 29 LLKCRERLRTIDPKWSDPSPDPCASGSYMHRAALF 63