BLASTX nr result
ID: Sinomenium22_contig00009495
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00009495 (829 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB45022.1| Double-stranded RNA-binding protein 2 [Morus nota... 57 6e-06 >gb|EXB45022.1| Double-stranded RNA-binding protein 2 [Morus notabilis] Length = 677 Score = 57.4 bits (137), Expect = 6e-06 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = +3 Query: 3 SVVPVCSAPPVRKMPESSEQGLISSDEKRTKEPKPEDISSASTELGKLQI 152 SVVPVCSAPP RK P SS++G S+ EK+ K+ +++S AS+ELGKLQI Sbjct: 630 SVVPVCSAPPPRKKPGSSQEGTSSNMEKKDKD--QDNMSKASSELGKLQI 677