BLASTX nr result
ID: Sinomenium22_contig00009464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00009464 (438 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007200807.1| hypothetical protein PRUPE_ppa025448mg [Prun... 69 5e-10 ref|XP_006487254.1| PREDICTED: uncharacterized protein LOC102615... 69 9e-10 ref|XP_007042112.1| Uncharacterized protein TCM_006837 [Theobrom... 68 2e-09 gb|EXC04408.1| hypothetical protein L484_008744 [Morus notabilis] 67 2e-09 ref|XP_006423371.1| hypothetical protein CICLE_v10030122mg [Citr... 67 3e-09 ref|XP_002313779.1| hypothetical protein POPTR_0009s12270g [Popu... 65 1e-08 ref|XP_006362033.1| PREDICTED: uncharacterized protein LOC102589... 64 2e-08 ref|XP_006362032.1| PREDICTED: uncharacterized protein LOC102589... 64 2e-08 ref|NP_001236665.1| uncharacterized protein LOC100500603 precurs... 64 2e-08 ref|XP_004230979.1| PREDICTED: uncharacterized protein LOC101246... 64 3e-08 ref|XP_004230978.1| PREDICTED: uncharacterized protein LOC101246... 64 3e-08 ref|XP_002283641.1| PREDICTED: uncharacterized protein LOC100245... 64 3e-08 emb|CAN82852.1| hypothetical protein VITISV_041720 [Vitis vinifera] 64 3e-08 ref|XP_007133799.1| hypothetical protein PHAVU_011G210100g [Phas... 63 4e-08 gb|EYU37822.1| hypothetical protein MIMGU_mgv1a017142mg [Mimulus... 62 8e-08 ref|XP_004511055.1| PREDICTED: uncharacterized protein LOC101496... 62 8e-08 ref|XP_004511001.1| PREDICTED: uncharacterized protein LOC101504... 62 8e-08 ref|XP_003627749.1| hypothetical protein MTR_8g037800 [Medicago ... 62 8e-08 >ref|XP_007200807.1| hypothetical protein PRUPE_ppa025448mg [Prunus persica] gi|462396207|gb|EMJ02006.1| hypothetical protein PRUPE_ppa025448mg [Prunus persica] Length = 92 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 AAEIHERLLKVNTKDYGRYDPAPALVKPPFKLIPN 107 AA IHERLL+ NT+DYGRYDPAPALVKPPFKLIPN Sbjct: 58 AAIIHERLLRANTRDYGRYDPAPALVKPPFKLIPN 92 >ref|XP_006487254.1| PREDICTED: uncharacterized protein LOC102615542 [Citrus sinensis] Length = 89 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 12 IHERLLKVNTKDYGRYDPAPALVKPPFKLIPN 107 IHERLLK NTKDYGRYDP+PALVKPPFKLIPN Sbjct: 58 IHERLLKANTKDYGRYDPSPALVKPPFKLIPN 89 >ref|XP_007042112.1| Uncharacterized protein TCM_006837 [Theobroma cacao] gi|508706047|gb|EOX97943.1| Uncharacterized protein TCM_006837 [Theobroma cacao] Length = 84 Score = 67.8 bits (164), Expect = 2e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 AAEIHERLLKVNTKDYGRYDPAPALVKPPFKLIPN 107 A +HERLL+ NTKDYGRYDP+PA+VKPPFKLIPN Sbjct: 50 ATSVHERLLRANTKDYGRYDPSPAIVKPPFKLIPN 84 >gb|EXC04408.1| hypothetical protein L484_008744 [Morus notabilis] Length = 93 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 6 AEIHERLLKVNTKDYGRYDPAPALVKPPFKLIPN 107 A +HERLL+ NTKDYG+YDPAPALVKPPFKLIPN Sbjct: 60 AIVHERLLRANTKDYGKYDPAPALVKPPFKLIPN 93 >ref|XP_006423371.1| hypothetical protein CICLE_v10030122mg [Citrus clementina] gi|557525305|gb|ESR36611.1| hypothetical protein CICLE_v10030122mg [Citrus clementina] Length = 89 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 12 IHERLLKVNTKDYGRYDPAPALVKPPFKLIPN 107 IHERLLK NT+DYGRYDP+PALVKPPFKLIPN Sbjct: 58 IHERLLKANTQDYGRYDPSPALVKPPFKLIPN 89 >ref|XP_002313779.1| hypothetical protein POPTR_0009s12270g [Populus trichocarpa] gi|222850187|gb|EEE87734.1| hypothetical protein POPTR_0009s12270g [Populus trichocarpa] Length = 94 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +3 Query: 3 AAEIHERLLKVNTKDYGRYDPAPALVKPPFKLIPN 107 A IHERLLK NTKDYG Y PAPALV+PPFKLIPN Sbjct: 60 ATTIHERLLKANTKDYGNYKPAPALVRPPFKLIPN 94 >ref|XP_006362033.1| PREDICTED: uncharacterized protein LOC102589836 isoform X2 [Solanum tuberosum] Length = 83 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 15 HERLLKVNTKDYGRYDPAPALVKPPFKLIPN 107 HER+LK+NTKDYGRYDP+PAL KPPFKLIPN Sbjct: 53 HERVLKMNTKDYGRYDPSPALSKPPFKLIPN 83 >ref|XP_006362032.1| PREDICTED: uncharacterized protein LOC102589836 isoform X1 [Solanum tuberosum] Length = 84 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 15 HERLLKVNTKDYGRYDPAPALVKPPFKLIPN 107 HER+LK+NTKDYGRYDP+PAL KPPFKLIPN Sbjct: 54 HERVLKMNTKDYGRYDPSPALSKPPFKLIPN 84 >ref|NP_001236665.1| uncharacterized protein LOC100500603 precursor [Glycine max] gi|255630736|gb|ACU15729.1| unknown [Glycine max] Length = 93 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 12 IHERLLKVNTKDYGRYDPAPALVKPPFKLIPN 107 IHERLL+ NTKDYGRYDP+P+L KPPFKLIPN Sbjct: 62 IHERLLRANTKDYGRYDPSPSLSKPPFKLIPN 93 >ref|XP_004230979.1| PREDICTED: uncharacterized protein LOC101246971 isoform 2 [Solanum lycopersicum] Length = 79 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 15 HERLLKVNTKDYGRYDPAPALVKPPFKLIPN 107 HER+LK+NTKDYGRYDP PAL KPPFKLIPN Sbjct: 49 HERVLKMNTKDYGRYDPTPALSKPPFKLIPN 79 >ref|XP_004230978.1| PREDICTED: uncharacterized protein LOC101246971 isoform 1 [Solanum lycopersicum] Length = 84 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 15 HERLLKVNTKDYGRYDPAPALVKPPFKLIPN 107 HER+LK+NTKDYGRYDP PAL KPPFKLIPN Sbjct: 54 HERVLKMNTKDYGRYDPTPALSKPPFKLIPN 84 >ref|XP_002283641.1| PREDICTED: uncharacterized protein LOC100245294 [Vitis vinifera] gi|297744426|emb|CBI37688.3| unnamed protein product [Vitis vinifera] Length = 95 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 AAEIHERLLKVNTKDYGRYDPAPALVKPPFKLIPN 107 A IHERLL+ NT+DYG YDPAPAL KPPFKLIPN Sbjct: 61 AEAIHERLLRANTRDYGNYDPAPALGKPPFKLIPN 95 >emb|CAN82852.1| hypothetical protein VITISV_041720 [Vitis vinifera] Length = 249 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 AAEIHERLLKVNTKDYGRYDPAPALVKPPFKLIPN 107 A IHERLL+ NT+DYG YDPAPAL KPPFKLIPN Sbjct: 215 AEAIHERLLRANTRDYGNYDPAPALGKPPFKLIPN 249 >ref|XP_007133799.1| hypothetical protein PHAVU_011G210100g [Phaseolus vulgaris] gi|561006799|gb|ESW05793.1| hypothetical protein PHAVU_011G210100g [Phaseolus vulgaris] Length = 92 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 6 AEIHERLLKVNTKDYGRYDPAPALVKPPFKLIPN 107 + IHER+L+ NTKDYGRYDP+P+L KPPFKLIPN Sbjct: 59 SSIHERVLRANTKDYGRYDPSPSLSKPPFKLIPN 92 >gb|EYU37822.1| hypothetical protein MIMGU_mgv1a017142mg [Mimulus guttatus] Length = 91 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 12 IHERLLKVNTKDYGRYDPAPALVKPPFKLIPN 107 IHER+LKV T DYG YDPAPA VKPPFKLIPN Sbjct: 60 IHERVLKVKTNDYGSYDPAPAFVKPPFKLIPN 91 >ref|XP_004511055.1| PREDICTED: uncharacterized protein LOC101496044 [Cicer arietinum] Length = 40 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 6 AEIHERLLKVNTKDYGRYDPAPALVKPPFKLIPN 107 + IHERLL+ NTKDYGRYDP P KPPFKLIPN Sbjct: 7 SNIHERLLRANTKDYGRYDPTPTFSKPPFKLIPN 40 >ref|XP_004511001.1| PREDICTED: uncharacterized protein LOC101504121 [Cicer arietinum] Length = 91 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 6 AEIHERLLKVNTKDYGRYDPAPALVKPPFKLIPN 107 + IHERLL+ NTKDYGRYDP P KPPFKLIPN Sbjct: 58 SNIHERLLRANTKDYGRYDPTPTFSKPPFKLIPN 91 >ref|XP_003627749.1| hypothetical protein MTR_8g037800 [Medicago truncatula] gi|355521771|gb|AET02225.1| hypothetical protein MTR_8g037800 [Medicago truncatula] gi|388492214|gb|AFK34173.1| unknown [Medicago truncatula] Length = 91 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 12 IHERLLKVNTKDYGRYDPAPALVKPPFKLIPN 107 IHERLL+ NTKDYGRYDP+P KPPFKLIPN Sbjct: 60 IHERLLRANTKDYGRYDPSPTFSKPPFKLIPN 91