BLASTX nr result
ID: Sinomenium22_contig00009239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00009239 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006846805.1| hypothetical protein AMTR_s00148p00069790 [A... 56 5e-06 >ref|XP_006846805.1| hypothetical protein AMTR_s00148p00069790 [Amborella trichopoda] gi|548849627|gb|ERN08386.1| hypothetical protein AMTR_s00148p00069790 [Amborella trichopoda] Length = 647 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/39 (71%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -3 Query: 368 RLVLLTSKARSWRAHDDE-IVDITEPRLESFWQVNPQSL 255 RLVLLTS+ARSWR+ + E VD+TEPR ESFWQ N QSL Sbjct: 609 RLVLLTSRARSWRSVEGESAVDLTEPRFESFWQANVQSL 647