BLASTX nr result
ID: Sinomenium22_contig00009074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00009074 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322266.2| hypothetical protein POPTR_0015s10960g [Popu... 61 1e-07 ref|XP_006374563.1| hypothetical protein POPTR_0015s10960g [Popu... 61 1e-07 ref|XP_006374562.1| hypothetical protein POPTR_0015s10960g [Popu... 61 1e-07 ref|XP_007209682.1| hypothetical protein PRUPE_ppa012307mg [Prun... 57 2e-06 ref|XP_002280221.1| PREDICTED: thylakoid lumenal 17.9 kDa protei... 57 2e-06 emb|CAN73868.1| hypothetical protein VITISV_001274 [Vitis vinifera] 57 2e-06 >ref|XP_002322266.2| hypothetical protein POPTR_0015s10960g [Populus trichocarpa] gi|550322460|gb|EEF06393.2| hypothetical protein POPTR_0015s10960g [Populus trichocarpa] Length = 230 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -1 Query: 108 PLPSLGIPSLNSQTNFLPPTTPFSQSKNLQIGIEDG 1 PLPSL IPSLNSQ L PTTPFSQSKNLQIG+E+G Sbjct: 61 PLPSLAIPSLNSQPPLLSPTTPFSQSKNLQIGLENG 96 >ref|XP_006374563.1| hypothetical protein POPTR_0015s10960g [Populus trichocarpa] gi|550322459|gb|ERP52360.1| hypothetical protein POPTR_0015s10960g [Populus trichocarpa] Length = 165 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -1 Query: 108 PLPSLGIPSLNSQTNFLPPTTPFSQSKNLQIGIEDG 1 PLPSL IPSLNSQ L PTTPFSQSKNLQIG+E+G Sbjct: 61 PLPSLAIPSLNSQPPLLSPTTPFSQSKNLQIGLENG 96 >ref|XP_006374562.1| hypothetical protein POPTR_0015s10960g [Populus trichocarpa] gi|550322458|gb|ERP52359.1| hypothetical protein POPTR_0015s10960g [Populus trichocarpa] Length = 136 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -1 Query: 108 PLPSLGIPSLNSQTNFLPPTTPFSQSKNLQIGIEDG 1 PLPSL IPSLNSQ L PTTPFSQSKNLQIG+E+G Sbjct: 61 PLPSLAIPSLNSQPPLLSPTTPFSQSKNLQIGLENG 96 >ref|XP_007209682.1| hypothetical protein PRUPE_ppa012307mg [Prunus persica] gi|462405417|gb|EMJ10881.1| hypothetical protein PRUPE_ppa012307mg [Prunus persica] Length = 175 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = -1 Query: 108 PLPSLGIPSLNSQTNFLPP-TTPFSQSKNLQIGIEDG 1 P P+L +PSLNSQ+N +PP TTPFSQSKNLQ G+E+G Sbjct: 5 PFPALAVPSLNSQSNLVPPPTTPFSQSKNLQTGLENG 41 >ref|XP_002280221.1| PREDICTED: thylakoid lumenal 17.9 kDa protein, chloroplastic [Vitis vinifera] gi|297734440|emb|CBI15687.3| unnamed protein product [Vitis vinifera] Length = 226 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = -1 Query: 99 SLGIPSLNSQTNFLPPTTPFSQSKNLQIGIEDG 1 SL +PS+NSQ++ LPPTTPFSQSKNLQ+G+E+G Sbjct: 60 SLALPSINSQSSLLPPTTPFSQSKNLQVGLENG 92 >emb|CAN73868.1| hypothetical protein VITISV_001274 [Vitis vinifera] Length = 786 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = -1 Query: 99 SLGIPSLNSQTNFLPPTTPFSQSKNLQIGIEDG 1 SL +PS+NSQ++ LPPTTPFSQSKNLQ+G+E+G Sbjct: 60 SLALPSINSQSSLLPPTTPFSQSKNLQVGLENG 92