BLASTX nr result
ID: Sinomenium22_contig00008784
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00008784 (501 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001304161.1| trichohyalin [Trichomonas vaginalis G3] gi|1... 59 7e-07 >ref|XP_001304161.1| trichohyalin [Trichomonas vaginalis G3] gi|121885594|gb|EAX91231.1| trichohyalin, putative [Trichomonas vaginalis G3] Length = 1071 Score = 58.9 bits (141), Expect = 7e-07 Identities = 40/153 (26%), Positives = 76/153 (49%), Gaps = 10/153 (6%) Frame = -1 Query: 429 KSKEKRRSSNYAKERRMQISIMQREKKKFHSCKG*EKSTNTKKIAKGKRRVQIPRRLQRG 250 K KE++ K + +I Q+EK+ + + EK +K + K + +I R +R Sbjct: 595 KEKEQKEKEEREKAEKQRIEREQKEKEAREAKERAEKEERERKEKEQKEKERIER--ERK 652 Query: 249 EKNANPIRCKERRES----------NTMPKREEIPIMQRVREECKYQEDCKGERRMQIQF 100 EK A + KE +E ++EE ++R ++E + +E + E R + + Sbjct: 653 EKEAREAKEKEEKEKAEREIKEKEERERKQKEEKERLEREKKEREEKEKIELEARKKAER 712 Query: 99 DAKEREESNSMQIEKRIQYDAKERRRVQFDAKE 1 + KEREE ++E++ Q + +ER R++ + KE Sbjct: 713 EQKEREEKEKRELEEKAQKEKEERERIEREEKE 745