BLASTX nr result
ID: Sinomenium22_contig00008431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00008431 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007212886.1| hypothetical protein PRUPE_ppa021750mg, part... 67 2e-09 ref|XP_007224309.1| hypothetical protein PRUPE_ppa019854mg [Prun... 67 3e-09 ref|XP_007224290.1| hypothetical protein PRUPE_ppa020085mg, part... 67 3e-09 ref|XP_007221093.1| hypothetical protein PRUPE_ppa017388mg, part... 67 3e-09 ref|XP_007214027.1| hypothetical protein PRUPE_ppa016677mg [Prun... 67 3e-09 ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, part... 67 3e-09 ref|XP_007206246.1| hypothetical protein PRUPE_ppa015607mg, part... 67 3e-09 ref|XP_007199160.1| hypothetical protein PRUPE_ppa019714mg, part... 67 3e-09 ref|XP_007204126.1| hypothetical protein PRUPE_ppa024273mg, part... 66 6e-09 ref|XP_007224597.1| hypothetical protein PRUPE_ppa027084mg, part... 65 7e-09 ref|XP_007201486.1| hypothetical protein PRUPE_ppa016462mg, part... 63 4e-08 ref|XP_007202950.1| hypothetical protein PRUPE_ppa016504mg, part... 62 8e-08 emb|CAN70431.1| hypothetical protein VITISV_030910 [Vitis vinifera] 62 1e-07 emb|CAN73539.1| hypothetical protein VITISV_037097 [Vitis vinifera] 62 1e-07 emb|CAN72548.1| hypothetical protein VITISV_035350 [Vitis vinifera] 62 1e-07 emb|CAN75040.1| hypothetical protein VITISV_026478 [Vitis vinifera] 62 1e-07 emb|CAN73452.1| hypothetical protein VITISV_028992 [Vitis vinifera] 62 1e-07 emb|CAN63022.1| hypothetical protein VITISV_042518 [Vitis vinifera] 62 1e-07 emb|CAN68820.1| hypothetical protein VITISV_009132 [Vitis vinifera] 61 1e-07 emb|CAN74795.1| hypothetical protein VITISV_041690 [Vitis vinifera] 61 1e-07 >ref|XP_007212886.1| hypothetical protein PRUPE_ppa021750mg, partial [Prunus persica] gi|462408751|gb|EMJ14085.1| hypothetical protein PRUPE_ppa021750mg, partial [Prunus persica] Length = 922 Score = 67.4 bits (163), Expect = 2e-09 Identities = 24/49 (48%), Positives = 37/49 (75%) Frame = +3 Query: 6 FGWIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRCTF 152 F W+ + +IN+ D +Q +P +C+SPSWC+LCK+N E +DHLFL C++ Sbjct: 798 FVWLAANGRINTCDCIQRRQPKMCLSPSWCVLCKENAENIDHLFLHCSY 846 >ref|XP_007224309.1| hypothetical protein PRUPE_ppa019854mg [Prunus persica] gi|462421245|gb|EMJ25508.1| hypothetical protein PRUPE_ppa019854mg [Prunus persica] Length = 469 Score = 66.6 bits (161), Expect = 3e-09 Identities = 23/49 (46%), Positives = 37/49 (75%) Frame = +3 Query: 6 FGWIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRCTF 152 F W+ + +IN+ D +Q +P +C+SPSWC+LCK+N E +DHLF+ C++ Sbjct: 312 FVWLAANGRINTCDCIQRRQPKMCLSPSWCVLCKENAENIDHLFIHCSY 360 Score = 38.5 bits (88), Expect(2) = 6e-06 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = +2 Query: 185 FGWLLAIRKINSMDLMQASRPYLCLSSCWCVHGKE 289 F WL A +IN+ D +Q +P +CLS WCV KE Sbjct: 312 FVWLAANGRINTCDCIQRRQPKMCLSPSWCVLCKE 346 Score = 37.0 bits (84), Expect(2) = 6e-06 Identities = 13/34 (38%), Positives = 24/34 (70%) Frame = +3 Query: 279 MARNSEETVNLLFIHCTFSQVIWYKVLEILGLCW 380 + + + E ++ LFIHC++S +W+K+L LG+ W Sbjct: 343 LCKENAENIDHLFIHCSYSLRLWWKMLGALGVEW 376 >ref|XP_007224290.1| hypothetical protein PRUPE_ppa020085mg, partial [Prunus persica] gi|462421226|gb|EMJ25489.1| hypothetical protein PRUPE_ppa020085mg, partial [Prunus persica] Length = 1117 Score = 66.6 bits (161), Expect = 3e-09 Identities = 23/49 (46%), Positives = 37/49 (75%) Frame = +3 Query: 6 FGWIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRCTF 152 F W+ + +IN+ D +Q +P +C+SPSWC+LCK+N E +DHLF+ C++ Sbjct: 1022 FVWLAANGRINTCDCIQRRQPKMCLSPSWCVLCKENAENIDHLFIHCSY 1070 Score = 38.5 bits (88), Expect(2) = 4e-06 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = +2 Query: 185 FGWLLAIRKINSMDLMQASRPYLCLSSCWCVHGKE 289 F WL A +IN+ D +Q +P +CLS WCV KE Sbjct: 1022 FVWLAANGRINTCDCIQRRQPKMCLSPSWCVLCKE 1056 Score = 37.7 bits (86), Expect(2) = 4e-06 Identities = 13/38 (34%), Positives = 26/38 (68%) Frame = +3 Query: 279 MARNSEETVNLLFIHCTFSQVIWYKVLEILGLCWATLR 392 + + + E ++ LFIHC++S +W+++L LG+ W L+ Sbjct: 1053 LCKENAENIDHLFIHCSYSLRLWWRMLGALGVEWVLLK 1090 >ref|XP_007221093.1| hypothetical protein PRUPE_ppa017388mg, partial [Prunus persica] gi|462417555|gb|EMJ22292.1| hypothetical protein PRUPE_ppa017388mg, partial [Prunus persica] Length = 291 Score = 66.6 bits (161), Expect = 3e-09 Identities = 23/49 (46%), Positives = 37/49 (75%) Frame = +3 Query: 6 FGWIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRCTF 152 F W+ + +IN+ D +Q +P +C+SPSWC+LCK+N E +DHLF+ C++ Sbjct: 134 FVWLAANGRINTCDCIQRRQPKICLSPSWCVLCKENAENIDHLFIHCSY 182 >ref|XP_007214027.1| hypothetical protein PRUPE_ppa016677mg [Prunus persica] gi|462409892|gb|EMJ15226.1| hypothetical protein PRUPE_ppa016677mg [Prunus persica] Length = 1421 Score = 66.6 bits (161), Expect = 3e-09 Identities = 23/49 (46%), Positives = 37/49 (75%) Frame = +3 Query: 6 FGWIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRCTF 152 F W+ + +IN+ D +Q +P +C+SPSWC+LCK+N E +DHLF+ C++ Sbjct: 1305 FVWLAANGRINTCDCIQRRQPKMCLSPSWCVLCKENAENIDHLFIHCSY 1353 Score = 38.5 bits (88), Expect(2) = 4e-06 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = +2 Query: 185 FGWLLAIRKINSMDLMQASRPYLCLSSCWCVHGKE 289 F WL A +IN+ D +Q +P +CLS WCV KE Sbjct: 1305 FVWLAANGRINTCDCIQRRQPKMCLSPSWCVLCKE 1339 Score = 37.7 bits (86), Expect(2) = 4e-06 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +3 Query: 279 MARNSEETVNLLFIHCTFSQVIWYKVLEILGLCWATLR 392 + + + E ++ LFIHC++S +W+K+L LG+ W R Sbjct: 1336 LCKENAENIDHLFIHCSYSLRLWWKMLGALGVEWRNQR 1373 >ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica] gi|462408445|gb|EMJ13779.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica] Length = 1499 Score = 66.6 bits (161), Expect = 3e-09 Identities = 23/49 (46%), Positives = 37/49 (75%) Frame = +3 Query: 6 FGWIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRCTF 152 F W+ + +IN+ D +Q +P +C+SPSWC+LCK+N E +DHLF+ C++ Sbjct: 1342 FVWLAANGRINTCDCIQRRQPKMCLSPSWCVLCKENAENIDHLFIHCSY 1390 Score = 38.5 bits (88), Expect(2) = 6e-06 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = +2 Query: 185 FGWLLAIRKINSMDLMQASRPYLCLSSCWCVHGKE 289 F WL A +IN+ D +Q +P +CLS WCV KE Sbjct: 1342 FVWLAANGRINTCDCIQRRQPKMCLSPSWCVLCKE 1376 Score = 37.0 bits (84), Expect(2) = 6e-06 Identities = 13/34 (38%), Positives = 24/34 (70%) Frame = +3 Query: 279 MARNSEETVNLLFIHCTFSQVIWYKVLEILGLCW 380 + + + E ++ LFIHC++S +W+K+L LG+ W Sbjct: 1373 LCKENAENIDHLFIHCSYSLRLWWKMLGALGVEW 1406 >ref|XP_007206246.1| hypothetical protein PRUPE_ppa015607mg, partial [Prunus persica] gi|462401888|gb|EMJ07445.1| hypothetical protein PRUPE_ppa015607mg, partial [Prunus persica] Length = 928 Score = 66.6 bits (161), Expect = 3e-09 Identities = 23/49 (46%), Positives = 37/49 (75%) Frame = +3 Query: 6 FGWIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRCTF 152 F W+ + +IN+ D +Q +P +C+SPSWC+LCK+N E +DHLF+ C++ Sbjct: 805 FVWLAANGRINTCDCIQRRQPKMCLSPSWCVLCKENAENIDHLFIHCSY 853 >ref|XP_007199160.1| hypothetical protein PRUPE_ppa019714mg, partial [Prunus persica] gi|462394560|gb|EMJ00359.1| hypothetical protein PRUPE_ppa019714mg, partial [Prunus persica] Length = 429 Score = 66.6 bits (161), Expect = 3e-09 Identities = 23/49 (46%), Positives = 37/49 (75%) Frame = +3 Query: 6 FGWIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRCTF 152 F W+ + +IN+ D +Q +P +C+SPSWC+LCK+N E +DHLF+ C++ Sbjct: 272 FVWLAANGRINTCDCIQRRQPKMCLSPSWCVLCKENAENIDHLFIHCSY 320 >ref|XP_007204126.1| hypothetical protein PRUPE_ppa024273mg, partial [Prunus persica] gi|462399657|gb|EMJ05325.1| hypothetical protein PRUPE_ppa024273mg, partial [Prunus persica] Length = 212 Score = 65.9 bits (159), Expect = 6e-09 Identities = 24/50 (48%), Positives = 37/50 (74%) Frame = +3 Query: 3 IFGWIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRCTF 152 +F W+ + K+N+ D++Q RP++ +SP WC+LCK EE++DHLFL C F Sbjct: 111 VFVWLVALGKVNTSDLVQRKRPFMYLSPHWCVLCKHCEESVDHLFLHCPF 160 >ref|XP_007224597.1| hypothetical protein PRUPE_ppa027084mg, partial [Prunus persica] gi|462421533|gb|EMJ25796.1| hypothetical protein PRUPE_ppa027084mg, partial [Prunus persica] Length = 295 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/80 (37%), Positives = 48/80 (60%), Gaps = 2/80 (2%) Frame = +3 Query: 3 IFGWIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRCTFEKIRSS*R*K 182 +F W+ + K+N+ D++Q RP++ +SP WC+LCK EE++DHLFL C F Sbjct: 137 VFVWLVALGKVNTSDLVQRKRPFMYLSPQWCVLCKLCEESVDHLFLHCPFS--------- 187 Query: 183 FLDGYWPLERLI--LWILCK 236 L +W L R + +W++ K Sbjct: 188 -LSLWWLLWREVGTVWVIPK 206 >ref|XP_007201486.1| hypothetical protein PRUPE_ppa016462mg, partial [Prunus persica] gi|462396886|gb|EMJ02685.1| hypothetical protein PRUPE_ppa016462mg, partial [Prunus persica] Length = 983 Score = 63.2 bits (152), Expect = 4e-08 Identities = 22/49 (44%), Positives = 35/49 (71%) Frame = +3 Query: 6 FGWIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRCTF 152 F W+ +IN+ D +Q +P +C+ PSWC+LCK+N E +DHLF+ C++ Sbjct: 870 FVWLAVNGRINTCDCIQRRQPKMCLYPSWCVLCKENAENIDHLFIHCSY 918 >ref|XP_007202950.1| hypothetical protein PRUPE_ppa016504mg, partial [Prunus persica] gi|462398481|gb|EMJ04149.1| hypothetical protein PRUPE_ppa016504mg, partial [Prunus persica] Length = 1162 Score = 62.0 bits (149), Expect = 8e-08 Identities = 22/49 (44%), Positives = 36/49 (73%) Frame = +3 Query: 6 FGWIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRCTF 152 F W+ + +IN+ D +Q +P + +SPSWC+LCK+N E +DHLF+ C++ Sbjct: 1049 FVWLAANGRINTCDCIQRRQPKMRLSPSWCVLCKENAENIDHLFIHCSY 1097 >emb|CAN70431.1| hypothetical protein VITISV_030910 [Vitis vinifera] Length = 971 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = +3 Query: 12 WIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRC 146 WI + K+N+ D +Q RPY + P WCILCK N E++DHLFL C Sbjct: 722 WIVAHGKVNTNDKLQLRRPYKALCPQWCILCKANGESIDHLFLHC 766 >emb|CAN73539.1| hypothetical protein VITISV_037097 [Vitis vinifera] Length = 943 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = +3 Query: 12 WIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRC 146 WI + K+N+ D +Q RPY + P WCILCK N E++DHLFL C Sbjct: 838 WIVAHGKVNTNDKLQLRRPYKSLCPQWCILCKGNGESIDHLFLHC 882 >emb|CAN72548.1| hypothetical protein VITISV_035350 [Vitis vinifera] Length = 306 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = +3 Query: 12 WIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRC 146 WI + K+N+ D +Q RPY + P WCILCK N E++DHLFL C Sbjct: 162 WIVAHGKVNTNDKLQLRRPYKALCPQWCILCKANGESIDHLFLHC 206 >emb|CAN75040.1| hypothetical protein VITISV_026478 [Vitis vinifera] Length = 1776 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = +3 Query: 12 WIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRC 146 WI + K+N+ D +Q RPY + P WCILCK N E++DHLFL C Sbjct: 1619 WIVAHGKVNTNDKLQLRRPYKSLCPQWCILCKGNGESIDHLFLHC 1663 >emb|CAN73452.1| hypothetical protein VITISV_028992 [Vitis vinifera] Length = 298 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = +3 Query: 12 WIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRC 146 WI + K+N+ D +Q RPY + P WCILCK N E++DHLFL C Sbjct: 141 WIVAHGKVNTNDKLQLRRPYKSLCPQWCILCKGNGESIDHLFLHC 185 >emb|CAN63022.1| hypothetical protein VITISV_042518 [Vitis vinifera] Length = 311 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = +3 Query: 12 WIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRC 146 WI + K+N+ D +Q RPY + P WCILCK N E++DHLFL C Sbjct: 154 WIVAHGKVNTNDKLQLRRPYKSLCPQWCILCKGNRESIDHLFLYC 198 >emb|CAN68820.1| hypothetical protein VITISV_009132 [Vitis vinifera] Length = 1910 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = +3 Query: 12 WIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRC 146 WI + K+N+ D +Q RPY + P WCILCK N E++DHLFL C Sbjct: 1781 WIVAHGKVNTNDKLQLRRPYKSLYPQWCILCKGNGESIDHLFLHC 1825 >emb|CAN74795.1| hypothetical protein VITISV_041690 [Vitis vinifera] Length = 906 Score = 61.2 bits (147), Expect = 1e-07 Identities = 23/45 (51%), Positives = 31/45 (68%) Frame = +3 Query: 12 WIFSRRKINSMDVMQTSRPYLCISPSWCILCKDNEETMDHLFLRC 146 W+ + K+N+ D +Q RPY + P WCILCK N E++DHLFL C Sbjct: 749 WLVAHGKVNTNDKLQLRRPYKALCPQWCILCKGNGESIDHLFLHC 793