BLASTX nr result
ID: Sinomenium22_contig00008427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00008427 (449 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70994.1| hypothetical protein VITISV_038698 [Vitis vinifera] 67 3e-09 gb|EXB37620.1| hypothetical protein L484_021826 [Morus notabilis] 64 3e-08 >emb|CAN70994.1| hypothetical protein VITISV_038698 [Vitis vinifera] Length = 751 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/47 (63%), Positives = 39/47 (82%) Frame = -2 Query: 142 KSLWRPIERRCLSLLQRPNTRISILRIQCFMLRNSFQTNIHLFTKFI 2 +SLW PIER+CLSLLQ+ TR ++L+I FMLRN+ +TN +LFTKFI Sbjct: 145 QSLWSPIERKCLSLLQQSKTRANLLQIHAFMLRNALETNPNLFTKFI 191 >gb|EXB37620.1| hypothetical protein L484_021826 [Morus notabilis] Length = 594 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = -2 Query: 145 AKSLWRPIERRCLSLLQRPNTRISILRIQCFMLRNSFQTNIHLFTKFI 2 A+ LW IER+CL LLQ+ NTR S+L+I F+LRN+ +TN++L TKFI Sbjct: 2 AEQLWSSIERKCLHLLQQTNTRASLLQIHAFILRNALETNVNLLTKFI 49