BLASTX nr result
ID: Sinomenium22_contig00008168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00008168 (255 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845200.1| hypothetical protein AMTR_s00005p00248640 [A... 65 7e-09 ref|XP_007222067.1| hypothetical protein PRUPE_ppa003238mg [Prun... 62 6e-08 ref|XP_004229655.1| PREDICTED: conserved oligomeric Golgi comple... 62 6e-08 ref|XP_006345415.1| PREDICTED: conserved oligomeric Golgi comple... 62 8e-08 ref|XP_002516094.1| Conserved oligomeric Golgi complex component... 62 8e-08 gb|EXB57652.1| hypothetical protein L484_002999 [Morus notabilis] 61 2e-07 ref|XP_006453061.1| hypothetical protein CICLE_v10007867mg [Citr... 61 2e-07 ref|XP_006474432.1| PREDICTED: conserved oligomeric Golgi comple... 61 2e-07 ref|XP_002279909.2| PREDICTED: conserved oligomeric Golgi comple... 60 2e-07 ref|XP_007012332.1| Oligomeric Golgi complex component-related /... 59 9e-07 ref|XP_007012331.1| Oligomeric Golgi complex component-related /... 59 9e-07 ref|XP_007012330.1| Oligomeric Golgi complex component-related /... 59 9e-07 ref|XP_004303495.1| PREDICTED: conserved oligomeric Golgi comple... 58 1e-06 ref|XP_004141327.1| PREDICTED: conserved oligomeric Golgi comple... 57 3e-06 ref|XP_002308543.1| conserved oligomeric Golgi complex component... 56 4e-06 >ref|XP_006845200.1| hypothetical protein AMTR_s00005p00248640 [Amborella trichopoda] gi|548847713|gb|ERN06875.1| hypothetical protein AMTR_s00005p00248640 [Amborella trichopoda] Length = 581 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +3 Query: 132 MESENPEEATMGSGLLPLASVSQQPYVSELLSFTLDRLHKE 254 +ES + E ATM GLLPLAS +QQPYVSELLSFTLDRLHKE Sbjct: 4 LESNDSETATMALGLLPLASAAQQPYVSELLSFTLDRLHKE 44 >ref|XP_007222067.1| hypothetical protein PRUPE_ppa003238mg [Prunus persica] gi|462419003|gb|EMJ23266.1| hypothetical protein PRUPE_ppa003238mg [Prunus persica] Length = 590 Score = 62.4 bits (150), Expect = 6e-08 Identities = 33/42 (78%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = +3 Query: 132 MESENP-EEATMGSGLLPLASVSQQPYVSELLSFTLDRLHKE 254 MESEN E+++ + LLPLASVSQQPYVSELLSFTLDRLHKE Sbjct: 1 MESENAAEDSSAVASLLPLASVSQQPYVSELLSFTLDRLHKE 42 >ref|XP_004229655.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Solanum lycopersicum] Length = 576 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/42 (73%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = +3 Query: 132 MESENP-EEATMGSGLLPLASVSQQPYVSELLSFTLDRLHKE 254 M+SE+P +EA+ +GLLPLAS +QQPY+SELLSFTLDRLHKE Sbjct: 3 MDSEDPMDEASPVTGLLPLASAAQQPYISELLSFTLDRLHKE 44 >ref|XP_006345415.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Solanum tuberosum] Length = 577 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/42 (73%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = +3 Query: 132 MESENP-EEATMGSGLLPLASVSQQPYVSELLSFTLDRLHKE 254 M+SE+P +EA+ +G LPLAS SQQPY+SELLSFTLDRLHKE Sbjct: 3 MDSEDPMDEASPVTGFLPLASASQQPYISELLSFTLDRLHKE 44 >ref|XP_002516094.1| Conserved oligomeric Golgi complex component, putative [Ricinus communis] gi|223544580|gb|EEF46096.1| Conserved oligomeric Golgi complex component, putative [Ricinus communis] Length = 574 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +3 Query: 132 MESENPEEATMGSGLLPLASVSQQPYVSELLSFTLDRLHKE 254 ME EN ++ + + L+PLASVSQQPYVSELLSFTLDRLHKE Sbjct: 1 MEVENGDDTSAMANLIPLASVSQQPYVSELLSFTLDRLHKE 41 >gb|EXB57652.1| hypothetical protein L484_002999 [Morus notabilis] Length = 570 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/42 (78%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +3 Query: 132 MESENP-EEATMGSGLLPLASVSQQPYVSELLSFTLDRLHKE 254 ME E+ EEA+ GLLPLAS SQQPYVSELLSFTLDRLHKE Sbjct: 1 MEFEDAAEEASTVGGLLPLASASQQPYVSELLSFTLDRLHKE 42 >ref|XP_006453061.1| hypothetical protein CICLE_v10007867mg [Citrus clementina] gi|557556287|gb|ESR66301.1| hypothetical protein CICLE_v10007867mg [Citrus clementina] Length = 568 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 2/43 (4%) Frame = +3 Query: 132 MESENPEEATMGS--GLLPLASVSQQPYVSELLSFTLDRLHKE 254 ME+E ++AT S LLPLAS+SQQPYVSELLSFTLDRLHKE Sbjct: 1 METEKGDDATSASVASLLPLASLSQQPYVSELLSFTLDRLHKE 43 >ref|XP_006474432.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Citrus sinensis] gi|343887270|dbj|BAK61816.1| conserved oligomeric Golgi complex component [Citrus unshiu] Length = 568 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 2/43 (4%) Frame = +3 Query: 132 MESENPEEATMGS--GLLPLASVSQQPYVSELLSFTLDRLHKE 254 ME+E ++AT S LLPLAS+SQQPYVSELLSFTLDRLHKE Sbjct: 1 METETGDDATSSSVASLLPLASLSQQPYVSELLSFTLDRLHKE 43 >ref|XP_002279909.2| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Vitis vinifera] gi|296081667|emb|CBI20672.3| unnamed protein product [Vitis vinifera] Length = 571 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +3 Query: 132 MESENPEEATMGSGLLPLASVSQQPYVSELLSFTLDRLHKE 254 M+S+ E+++ + LLPLASVSQQPYVSELLSFTLDRLHKE Sbjct: 1 MDSDAAEDSSPMATLLPLASVSQQPYVSELLSFTLDRLHKE 41 >ref|XP_007012332.1| Oligomeric Golgi complex component-related / COG complex component-related isoform 3, partial [Theobroma cacao] gi|508782695|gb|EOY29951.1| Oligomeric Golgi complex component-related / COG complex component-related isoform 3, partial [Theobroma cacao] Length = 427 Score = 58.5 bits (140), Expect = 9e-07 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 8/49 (16%) Frame = +3 Query: 132 MESENPEEA--TMGS------GLLPLASVSQQPYVSELLSFTLDRLHKE 254 ME EN ++ T+ S GLLPLASVSQQPYVSELLSFTLDRLHKE Sbjct: 3 MELENGDDVLPTLASPTSAMAGLLPLASVSQQPYVSELLSFTLDRLHKE 51 >ref|XP_007012331.1| Oligomeric Golgi complex component-related / COG complex component-related isoform 2 [Theobroma cacao] gi|508782694|gb|EOY29950.1| Oligomeric Golgi complex component-related / COG complex component-related isoform 2 [Theobroma cacao] Length = 435 Score = 58.5 bits (140), Expect = 9e-07 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 8/49 (16%) Frame = +3 Query: 132 MESENPEEA--TMGS------GLLPLASVSQQPYVSELLSFTLDRLHKE 254 ME EN ++ T+ S GLLPLASVSQQPYVSELLSFTLDRLHKE Sbjct: 3 MELENGDDVLPTLASPTSAMAGLLPLASVSQQPYVSELLSFTLDRLHKE 51 >ref|XP_007012330.1| Oligomeric Golgi complex component-related / COG complex component-related isoform 1 [Theobroma cacao] gi|508782693|gb|EOY29949.1| Oligomeric Golgi complex component-related / COG complex component-related isoform 1 [Theobroma cacao] Length = 583 Score = 58.5 bits (140), Expect = 9e-07 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 8/49 (16%) Frame = +3 Query: 132 MESENPEEA--TMGS------GLLPLASVSQQPYVSELLSFTLDRLHKE 254 ME EN ++ T+ S GLLPLASVSQQPYVSELLSFTLDRLHKE Sbjct: 3 MELENGDDVLPTLASPTSAMAGLLPLASVSQQPYVSELLSFTLDRLHKE 51 >ref|XP_004303495.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Fragaria vesca subsp. vesca] Length = 597 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/43 (72%), Positives = 36/43 (83%), Gaps = 2/43 (4%) Frame = +3 Query: 132 MESENP--EEATMGSGLLPLASVSQQPYVSELLSFTLDRLHKE 254 MESEN E+++ + LLPLAS +QQPYVSELLSFTLDRLHKE Sbjct: 2 MESENAAAEDSSAVASLLPLASGAQQPYVSELLSFTLDRLHKE 44 >ref|XP_004141327.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Cucumis sativus] gi|449525202|ref|XP_004169607.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Cucumis sativus] Length = 570 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/43 (69%), Positives = 36/43 (83%), Gaps = 2/43 (4%) Frame = +3 Query: 132 MESENPEE--ATMGSGLLPLASVSQQPYVSELLSFTLDRLHKE 254 ME+EN +E ++ S LLPLAS +QQPYVSELLSFTLDRL+KE Sbjct: 1 METENADELASSTASTLLPLASAAQQPYVSELLSFTLDRLNKE 43 >ref|XP_002308543.1| conserved oligomeric Golgi complex component-related family protein [Populus trichocarpa] gi|222854519|gb|EEE92066.1| conserved oligomeric Golgi complex component-related family protein [Populus trichocarpa] Length = 575 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/40 (72%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = +3 Query: 138 SENPEEATMG-SGLLPLASVSQQPYVSELLSFTLDRLHKE 254 +EN ++ + + LLPLASVSQQPYVSELLSFTLDRLHKE Sbjct: 4 TENGQDMSSAVTSLLPLASVSQQPYVSELLSFTLDRLHKE 43