BLASTX nr result
ID: Sinomenium22_contig00007517
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00007517 (531 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK20892.1| unknown [Picea sitchensis] gi|116784174|gb|ABK232... 65 1e-08 ref|XP_004145344.1| PREDICTED: mitochondrial import receptor sub... 65 1e-08 gb|EXB63635.1| hypothetical protein L484_026977 [Morus notabilis] 64 2e-08 ref|XP_007019163.1| Translocase of the outer mitochondrial membr... 63 4e-08 ref|XP_007131882.1| hypothetical protein PHAVU_011G049200g [Phas... 62 6e-08 gb|EYU37743.1| hypothetical protein MIMGU_mgv1a016428mg [Mimulus... 62 8e-08 ref|XP_002313822.1| hypothetical protein POPTR_0009s11330g [Popu... 62 8e-08 ref|XP_004230848.1| PREDICTED: mitochondrial import receptor sub... 60 3e-07 ref|XP_006423157.1| hypothetical protein CICLE_v10029767mg [Citr... 59 5e-07 gb|EPS68378.1| hypothetical protein M569_06396, partial [Genlise... 59 5e-07 ref|XP_002519115.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_006590915.1| PREDICTED: mitochondrial import receptor sub... 59 7e-07 ref|XP_003541100.1| PREDICTED: mitochondrial import receptor sub... 59 7e-07 ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 f... 59 7e-07 ref|XP_006592291.1| PREDICTED: mitochondrial import receptor sub... 57 3e-06 ref|XP_002894180.1| hypothetical protein ARALYDRAFT_891816 [Arab... 57 3e-06 ref|XP_004492183.1| PREDICTED: mitochondrial import receptor sub... 56 6e-06 >gb|ABK20892.1| unknown [Picea sitchensis] gi|116784174|gb|ABK23244.1| unknown [Picea sitchensis] gi|116789568|gb|ABK25295.1| unknown [Picea sitchensis] Length = 55 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +3 Query: 90 MILGAIPRRPDKAIALKQLRTHVTMFGIWAAVVRLTPYVLH 212 M LGAIPRRPDKA A KQLR H+T+ GIW A +R+ PYV H Sbjct: 1 MFLGAIPRRPDKAAAYKQLRKHLTLLGIWVAAIRVAPYVAH 41 >ref|XP_004145344.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449455208|ref|XP_004145345.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474805|ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474809|ref|XP_004154291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532212|ref|XP_004173076.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532214|ref|XP_004173077.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] Length = 54 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +3 Query: 90 MILGAIPRRPDKAIALKQLRTHVTMFGIWAAVVRLTPYVLH 212 M G R+PDKA ALKQLR+HV MFG+W AV+R+TPYVLH Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLH 41 >gb|EXB63635.1| hypothetical protein L484_026977 [Morus notabilis] Length = 54 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +3 Query: 90 MILGAIPRRPDKAIALKQLRTHVTMFGIWAAVVRLTPYVLH 212 M G R+PDKA ALKQLRTHV MFG W AV+R+TPY+LH Sbjct: 1 MFPGMFMRKPDKAAALKQLRTHVAMFGAWVAVIRVTPYILH 41 >ref|XP_007019163.1| Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] gi|508724491|gb|EOY16388.1| Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] Length = 54 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 90 MILGAIPRRPDKAIALKQLRTHVTMFGIWAAVVRLTPYVLH 212 M G R+PDKA ALKQL+ HV MFG+W AVVR+TPY+LH Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPYILH 41 >ref|XP_007131882.1| hypothetical protein PHAVU_011G049200g [Phaseolus vulgaris] gi|561004882|gb|ESW03876.1| hypothetical protein PHAVU_011G049200g [Phaseolus vulgaris] Length = 54 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 90 MILGAIPRRPDKAIALKQLRTHVTMFGIWAAVVRLTPYVLH 212 M G R+PDKA ALKQL++HVTMFG W V+R+TPYVLH Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVTMFGAWVVVIRVTPYVLH 41 >gb|EYU37743.1| hypothetical protein MIMGU_mgv1a016428mg [Mimulus guttatus] Length = 122 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 84 RKMILGAIPRRPDKAIALKQLRTHVTMFGIWAAVVRLTPYVLH 212 +KM G R+PDKA ALKQLR+H MFG W AV+R+ PY+LH Sbjct: 67 KKMFPGMFMRKPDKAAALKQLRSHAAMFGAWVAVIRVAPYILH 109 >ref|XP_002313822.1| hypothetical protein POPTR_0009s11330g [Populus trichocarpa] gi|118483621|gb|ABK93705.1| unknown [Populus trichocarpa] gi|222850230|gb|EEE87777.1| hypothetical protein POPTR_0009s11330g [Populus trichocarpa] Length = 54 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = +3 Query: 90 MILGAIPRRPDKAIALKQLRTHVTMFGIWAAVVRLTPYVLHXXDHFK 230 M G ++PDKA ALKQLR+HV MFG W V+R+TPYVLH H K Sbjct: 1 MFPGLFMKKPDKAEALKQLRSHVAMFGAWVVVLRVTPYVLHYISHEK 47 >ref|XP_004230848.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum lycopersicum] gi|565399930|ref|XP_006365492.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum tuberosum] Length = 54 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = +3 Query: 90 MILGAIPRRPDKAIALKQLRTHVTMFGIWAAVVRLTPYVLH 212 M G R+PDKA ALKQL+THV +FG W AV+R+ PY+LH Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVVLFGTWVAVIRVAPYILH 41 >ref|XP_006423157.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|567861008|ref|XP_006423158.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|568851345|ref|XP_006479354.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X1 [Citrus sinensis] gi|568851347|ref|XP_006479355.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Citrus sinensis] gi|557525091|gb|ESR36397.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|557525092|gb|ESR36398.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] Length = 54 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = +3 Query: 90 MILGAIPRRPDKAIALKQLRTHVTMFGIWAAVVRLTPYVLH 212 M G ++PDKA ALKQLR+HV MFG W V+R+TPY+LH Sbjct: 1 MFPGMFMKKPDKAAALKQLRSHVAMFGTWVVVIRVTPYLLH 41 >gb|EPS68378.1| hypothetical protein M569_06396, partial [Genlisea aurea] Length = 54 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = +3 Query: 87 KMILGAIPRRPDKAIALKQLRTHVTMFGIWAAVVRLTPYVLH 212 KM G R+PDKA ALKQL++H MFG W AVVR PYVLH Sbjct: 1 KMFPGMFMRKPDKAAALKQLKSHAIMFGAWIAVVRAAPYVLH 42 >ref|XP_002519115.1| conserved hypothetical protein [Ricinus communis] gi|223541778|gb|EEF43326.1| conserved hypothetical protein [Ricinus communis] Length = 54 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = +3 Query: 90 MILGAIPRRPDKAIALKQLRTHVTMFGIWAAVVRLTPYVLH 212 M G R+PDKA ALKQL+TH +FG W A++R+TPYVLH Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHAAIFGAWVALIRVTPYVLH 41 >ref|XP_006590915.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Glycine max] Length = 54 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +3 Query: 90 MILGAIPRRPDKAIALKQLRTHVTMFGIWAAVVRLTPYVLH 212 M G R+PDKA ALKQL++H MFG W V+R+TPYVLH Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGAWVVVIRVTPYVLH 41 >ref|XP_003541100.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 1 [Glycine max] gi|255626599|gb|ACU13644.1| unknown [Glycine max] Length = 54 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +3 Query: 90 MILGAIPRRPDKAIALKQLRTHVTMFGIWAAVVRLTPYVLH 212 M G R+PDKA ALKQL++H MFG W V+R+TPYVLH Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGTWVVVIRVTPYVLH 41 >ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] gi|118484423|gb|ABK94088.1| unknown [Populus trichocarpa] gi|222848371|gb|EEE85918.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] Length = 54 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +3 Query: 90 MILGAIPRRPDKAIALKQLRTHVTMFGIWAAVVRLTPYVLH 212 M G R+PDKA ALKQL++HV MFG W V+R+TPYVLH Sbjct: 1 MFPGMFMRKPDKAEALKQLKSHVAMFGAWVVVLRVTPYVLH 41 >ref|XP_006592291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Glycine max] Length = 83 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 4/56 (7%) Frame = +3 Query: 90 MILGAIPRRPDKAIALKQLRTHVTMFGIWAAVVRLTPYVLH----XXDHFKLNRYL 245 M G R+PDKA ALKQL++HV MF W V+++TPYVLH + KL YL Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVVMFQAWVVVIQVTPYVLHFLSTEKEELKLELYL 56 >ref|XP_002894180.1| hypothetical protein ARALYDRAFT_891816 [Arabidopsis lyrata subsp. lyrata] gi|297340022|gb|EFH70439.1| hypothetical protein ARALYDRAFT_891816 [Arabidopsis lyrata subsp. lyrata] Length = 54 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = +3 Query: 90 MILGAIPRRPDKAIALKQLRTHVTMFGIWAAVVRLTPYVL 209 M G R+PDKA+ALKQLRTHV +FG W +VR PYVL Sbjct: 1 MFPGMFMRKPDKAVALKQLRTHVALFGGWVVIVRAVPYVL 40 >ref|XP_004492183.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cicer arietinum] Length = 54 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = +3 Query: 90 MILGAIPRRPDKAIALKQLRTHVTMFGIWAAVVRLTPYVLH 212 M G R+PDKA ALKQL++HV MFG W V+R+ PY+L+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVAMFGTWVVVIRVAPYILY 41