BLASTX nr result
ID: Sinomenium22_contig00005828
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00005828 (588 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007204566.1| hypothetical protein PRUPE_ppa003799mg [Prun... 62 2e-07 >ref|XP_007204566.1| hypothetical protein PRUPE_ppa003799mg [Prunus persica] gi|462400097|gb|EMJ05765.1| hypothetical protein PRUPE_ppa003799mg [Prunus persica] Length = 548 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/43 (58%), Positives = 30/43 (69%) Frame = -3 Query: 574 NPPAHQNPTTRYSEPYKYPNQAVYDGPVSASYMPPYGAAHTQN 446 NPP +P TRYS PY YP+Q+VYDGP +ASY YG H Q+ Sbjct: 453 NPPPQHSPATRYSGPYNYPSQSVYDGPTAASYGSTYGVPHAQS 495