BLASTX nr result
ID: Sinomenium22_contig00005699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00005699 (856 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_054563.1| NADH dehydrogenase subunit 7 [Nicotiana tabacum... 69 2e-12 gb|AHE41466.1| NADH-plastoquinone oxidoreductase subunit 7 (chlo... 69 2e-12 gb|AHE41465.1| NADH-plastoquinone oxidoreductase subunit 7 (chlo... 69 2e-12 gb|AHE41481.1| NADH-plastoquinone oxidoreductase subunit 7 (chlo... 69 2e-12 ref|YP_008815993.1| NADH dehydrogenase subunit 7 (chloroplast) [... 69 2e-12 ref|YP_008592690.1| NADH-plastoquinone oxidoreductase subunit 7 ... 69 2e-12 ref|YP_008592538.1| NADH dehydrogenase subunit 7 (chloroplast) [... 69 2e-12 gb|AFV61869.1| NADH dehydrogenase subunit 7 (chloroplast) [Origa... 69 2e-12 ref|YP_008081322.1| NADH dehydrogenase subunit 7 (chloroplast) [... 69 2e-12 ref|YP_008081422.1| NADH dehydrogenase subunit 7 (chloroplast) [... 69 2e-12 gb|AGJ51303.1| NADH dehydrogenase subunit 7 (chloroplast) [Solan... 69 2e-12 ref|YP_007507168.1| NADH dehydrogenase subunit 7 (chloroplast) [... 69 2e-12 ref|YP_007353971.1| NADH dehydrogenase subunit 7 (chloroplast) [... 69 2e-12 ref|YP_635695.1| NADH dehydrogenase subunit 7 [Solanum tuberosum... 69 2e-12 ref|YP_008563145.1| NADH-plastoquinone oxidoreductase subunit 7 ... 69 2e-12 ref|YP_398929.1| NADH dehydrogenase subunit 7 [Nicotiana tomento... 69 2e-12 ref|YP_005097930.1| NADH dehydrogenase subunit 7 (chloroplast) [... 69 2e-12 ref|YP_004935723.1| ndhH gene product (chloroplast) [Sesamum ind... 69 2e-12 ref|YP_004891672.1| ndhH gene product (chloroplast) [Nicotiana u... 69 2e-12 emb|CBR30465.1| NADH dehydrogenase subunit 7 [Olea europaea subs... 69 2e-12 >ref|NP_054563.1| NADH dehydrogenase subunit 7 [Nicotiana tabacum] gi|78102604|ref|YP_358743.1| NADH dehydrogenase subunit 7 [Nicotiana sylvestris] gi|128838|sp|P12133.1|NDHH_TOBAC RecName: Full=NAD(P)H-quinone oxidoreductase subunit H, chloroplastic; AltName: Full=NAD(P)H dehydrogenase subunit H; AltName: Full=NADH-plastoquinone oxidoreductase 49 kDa subunit; AltName: Full=NADH-plastoquinone oxidoreductase subunit H gi|122213585|sp|Q3C1P8.1|NDHH_NICSY RecName: Full=NAD(P)H-quinone oxidoreductase subunit H, chloroplastic; AltName: Full=NAD(P)H dehydrogenase subunit H; AltName: Full=NADH-plastoquinone oxidoreductase 49 kDa subunit; AltName: Full=NADH-plastoquinone oxidoreductase subunit H gi|1223674|emb|CAA77398.1| NADH dehydrogenase 49kD subunit [Nicotiana tabacum] gi|77799631|dbj|BAE46720.1| NADH dehydrogenase 49kD subunit [Nicotiana sylvestris] gi|225262|prf||1211235CX ORF 393 Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >gb|AHE41466.1| NADH-plastoquinone oxidoreductase subunit 7 (chloroplast) [Ribes fasciculatum var. chinense] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >gb|AHE41465.1| NADH-plastoquinone oxidoreductase subunit 7 (chloroplast) [Hamamelis mollis] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >gb|AHE41481.1| NADH-plastoquinone oxidoreductase subunit 7 (chloroplast) [Paeonia obovata] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >ref|YP_008815993.1| NADH dehydrogenase subunit 7 (chloroplast) [Lindenbergia philippensis] gi|557136920|emb|CDI43974.1| NADH dehydrogenase subunit 7 (chloroplast) [Lindenbergia philippensis] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >ref|YP_008592690.1| NADH-plastoquinone oxidoreductase subunit 7 (chloroplast) [Berberis bealei] gi|536462731|gb|AGU37096.1| NADH-plastoquinone oxidoreductase subunit 7 (chloroplast) [Berberis bealei] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >ref|YP_008592538.1| NADH dehydrogenase subunit 7 (chloroplast) [Andrographis paniculata] gi|532164886|gb|AGT79896.1| NADH dehydrogenase subunit 7 (chloroplast) [Andrographis paniculata] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >gb|AFV61869.1| NADH dehydrogenase subunit 7 (chloroplast) [Origanum vulgare subsp. vulgare] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >ref|YP_008081322.1| NADH dehydrogenase subunit 7 (chloroplast) [Catharanthus roseus] gi|474452133|gb|AGI51201.1| NADH dehydrogenase subunit 7 (chloroplast) [Catharanthus roseus] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >ref|YP_008081422.1| NADH dehydrogenase subunit 7 (chloroplast) [Tetracentron sinense] gi|479279259|gb|AGJ72113.1| NADH dehydrogenase subunit 7 (chloroplast) [Tetracentron sinense] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >gb|AGJ51303.1| NADH dehydrogenase subunit 7 (chloroplast) [Solanum carolinense] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >ref|YP_007507168.1| NADH dehydrogenase subunit 7 (chloroplast) [Salvia miltiorrhiza] gi|401879799|gb|AFQ30986.1| NADH dehydrogenase subunit 7 (chloroplast) [Salvia miltiorrhiza] gi|573462009|emb|CCQ71678.1| NADH dehydrogenase subunit 7 (chloroplast) [Salvia miltiorrhiza] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >ref|YP_007353971.1| NADH dehydrogenase subunit 7 (chloroplast) [Tectona grandis] gi|438687660|emb|CCP47189.1| NADH dehydrogenase subunit 7 (chloroplast) [Tectona grandis] gi|438688344|emb|CCP47278.1| NADH dehydrogenase subunit 7 (chloroplast) [Tectona grandis] gi|438688468|emb|CCP47367.1| NADH dehydrogenase subunit 7 (chloroplast) [Tectona grandis] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >ref|YP_635695.1| NADH dehydrogenase subunit 7 [Solanum tuberosum] gi|122209870|sp|Q2VEC5.1|NDHH_SOLTU RecName: Full=NAD(P)H-quinone oxidoreductase subunit H, chloroplastic; AltName: Full=NAD(P)H dehydrogenase subunit H; AltName: Full=NADH-plastoquinone oxidoreductase 49 kDa subunit; AltName: Full=NADH-plastoquinone oxidoreductase subunit H gi|82754679|gb|ABB90093.1| NADH dehydrogenase subunit 7 [Solanum tuberosum] gi|88656860|gb|ABD47113.1| NADH-plastoquinone oxidoreductase subunit 7 [Solanum tuberosum] gi|329124638|gb|AEB72195.1| NADH-plastoquinone oxidoreductase subunit 7 (chloroplast) [Solanum tuberosum] gi|329124725|gb|AEB72281.1| NADH-plastoquinone oxidoreductase subunit 7 (chloroplast) [Solanum tuberosum] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >ref|YP_008563145.1| NADH-plastoquinone oxidoreductase subunit 7 (chloroplast) [Solanum lycopersicum] gi|544170729|ref|AP_004985.1| NADH dehydrogenase subunit 7 (chloroplast) [Solanum lycopersicum] gi|122201761|sp|Q2MI44.1|NDHH_SOLLC RecName: Full=NAD(P)H-quinone oxidoreductase subunit H, chloroplastic; AltName: Full=NAD(P)H dehydrogenase subunit H; AltName: Full=NADH-plastoquinone oxidoreductase 49 kDa subunit; AltName: Full=NADH-plastoquinone oxidoreductase subunit H gi|84372040|gb|ABC56357.1| NADH-plastoquinone oxidoreductase subunit 7 (chloroplast) [Solanum lycopersicum] gi|89241728|emb|CAJ32451.1| NADH dehydrogenase subunit 7 [Solanum lycopersicum] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >ref|YP_398929.1| NADH dehydrogenase subunit 7 [Nicotiana tomentosiformis] gi|122212869|sp|Q33BW6.1|NDHH_NICTO RecName: Full=NAD(P)H-quinone oxidoreductase subunit H, chloroplastic; AltName: Full=NAD(P)H dehydrogenase subunit H; AltName: Full=NADH-plastoquinone oxidoreductase 49 kDa subunit; AltName: Full=NADH-plastoquinone oxidoreductase subunit H gi|80750993|dbj|BAE48069.1| NADH dehydrogenase 49kD subunit [Nicotiana tomentosiformis] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >ref|YP_005097930.1| NADH dehydrogenase subunit 7 (chloroplast) [Colocasia esculenta] gi|340536696|gb|AEK48463.1| NADH dehydrogenase subunit 7 (chloroplast) [Colocasia esculenta] gi|340536783|gb|AEK48549.1| NADH dehydrogenase subunit 7 (chloroplast) [Colocasia esculenta] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >ref|YP_004935723.1| ndhH gene product (chloroplast) [Sesamum indicum] gi|347448352|gb|AEO92763.1| NADH dehydrogenase subunit 7 (chloroplast) [Sesamum indicum] gi|496538657|gb|AGL45392.1| NdhH (chloroplast) [Sesamum indicum] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >ref|YP_004891672.1| ndhH gene product (chloroplast) [Nicotiana undulata] gi|347453972|gb|AEO95630.1| NADH-plastoquinone oxidoreductase subunit 7 (chloroplast) [Nicotiana undulata] gi|347454082|gb|AEO95739.1| NADH-plastoquinone oxidoreductase subunit 7 [synthetic construct] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392 >emb|CBR30465.1| NADH dehydrogenase subunit 7 [Olea europaea subsp. europaea] Length = 393 Score = 68.6 bits (166), Expect(2) = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 378 IFLIVDQSVFPWRWKIRPPGFINLQILPQLVK 283 IFLI DQSVFPWRWKIRPPGFINLQILPQLVK Sbjct: 339 IFLIGDQSVFPWRWKIRPPGFINLQILPQLVK 370 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -1 Query: 283 RMKLAAIMTILGSIVRCRFPHYIMGEVD 200 RMKLA IMTILGSI IMGEVD Sbjct: 371 RMKLADIMTILGSI------DIIMGEVD 392