BLASTX nr result
ID: Sinomenium22_contig00005560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00005560 (375 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006432564.1| hypothetical protein CICLE_v10000412mg [Citr... 59 9e-07 ref|XP_007029828.1| Mechanosensitive channel of small conductanc... 59 9e-07 ref|XP_007029827.1| Mechanosensitive channel of small conductanc... 59 9e-07 ref|XP_007220624.1| hypothetical protein PRUPE_ppa002215mg [Prun... 57 2e-06 ref|XP_004509542.1| PREDICTED: mechanosensitive ion channel prot... 55 1e-05 ref|XP_004159995.1| PREDICTED: mechanosensitive ion channel prot... 55 1e-05 ref|XP_004138929.1| PREDICTED: mechanosensitive ion channel prot... 55 1e-05 >ref|XP_006432564.1| hypothetical protein CICLE_v10000412mg [Citrus clementina] gi|568834449|ref|XP_006471341.1| PREDICTED: mechanosensitive ion channel protein 10-like [Citrus sinensis] gi|557534686|gb|ESR45804.1| hypothetical protein CICLE_v10000412mg [Citrus clementina] Length = 728 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +1 Query: 1 DLIFELKKIFENIGIKYHVLPQEIHLTQLPVASGRMPT 114 +LI ELKKIFEN+GIKYH+LPQEIH+TQL + + MP+ Sbjct: 689 ELILELKKIFENLGIKYHLLPQEIHITQLNLDNWTMPS 726 >ref|XP_007029828.1| Mechanosensitive channel of small conductance-like 10 isoform 2 [Theobroma cacao] gi|508718433|gb|EOY10330.1| Mechanosensitive channel of small conductance-like 10 isoform 2 [Theobroma cacao] Length = 612 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = +1 Query: 1 DLIFELKKIFENIGIKYHVLPQEIHLTQLPVASGRM 108 +L+FELKKIFE + IKYH+LPQE+HLTQ+ + +GRM Sbjct: 575 ELVFELKKIFETLNIKYHLLPQEVHLTQVNIPNGRM 610 >ref|XP_007029827.1| Mechanosensitive channel of small conductance-like 10 isoform 1 [Theobroma cacao] gi|508718432|gb|EOY10329.1| Mechanosensitive channel of small conductance-like 10 isoform 1 [Theobroma cacao] Length = 708 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = +1 Query: 1 DLIFELKKIFENIGIKYHVLPQEIHLTQLPVASGRM 108 +L+FELKKIFE + IKYH+LPQE+HLTQ+ + +GRM Sbjct: 671 ELVFELKKIFETLNIKYHLLPQEVHLTQVNIPNGRM 706 >ref|XP_007220624.1| hypothetical protein PRUPE_ppa002215mg [Prunus persica] gi|462417086|gb|EMJ21823.1| hypothetical protein PRUPE_ppa002215mg [Prunus persica] Length = 699 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/36 (63%), Positives = 34/36 (94%) Frame = +1 Query: 1 DLIFELKKIFENIGIKYHVLPQEIHLTQLPVASGRM 108 +L+FELKKIF+N+GI+YH+LPQE++LTQL ++GR+ Sbjct: 660 ELVFELKKIFQNLGIEYHLLPQEVNLTQLNASNGRL 695 >ref|XP_004509542.1| PREDICTED: mechanosensitive ion channel protein 10-like [Cicer arietinum] Length = 703 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 1 DLIFELKKIFENIGIKYHVLPQEIHLTQLPVASGRM 108 +L+ ELKKIFE GIKYH+LPQEIHLTQ+ V +GR+ Sbjct: 666 ELLLELKKIFEVHGIKYHLLPQEIHLTQMNVGNGRV 701 >ref|XP_004159995.1| PREDICTED: mechanosensitive ion channel protein 10-like [Cucumis sativus] Length = 174 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = +1 Query: 1 DLIFELKKIFENIGIKYHVLPQEIHLTQLPVASGRM 108 DLI ELK++FEN+GIKYH+LPQE+ +TQ + +GRM Sbjct: 134 DLILELKRVFENLGIKYHLLPQEVLVTQFNLTNGRM 169 >ref|XP_004138929.1| PREDICTED: mechanosensitive ion channel protein 10-like [Cucumis sativus] Length = 686 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = +1 Query: 1 DLIFELKKIFENIGIKYHVLPQEIHLTQLPVASGRM 108 DLI ELK++FEN+GIKYH+LPQE+ +TQ + +GRM Sbjct: 646 DLILELKRVFENLGIKYHLLPQEVLVTQFNLTNGRM 681