BLASTX nr result
ID: Sinomenium22_contig00004810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00004810 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007036236.1| SufE/NifU family protein [Theobroma cacao] g... 57 3e-06 ref|XP_007029235.1| SufE/NifU family protein isoform 2 [Theobrom... 57 3e-06 ref|XP_007029234.1| SufE/NifU family protein isoform 1 [Theobrom... 57 3e-06 ref|XP_006476786.1| PREDICTED: iron-sulfur cluster assembly prot... 56 6e-06 >ref|XP_007036236.1| SufE/NifU family protein [Theobroma cacao] gi|508773481|gb|EOY20737.1| SufE/NifU family protein [Theobroma cacao] Length = 171 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +3 Query: 3 SMLAEDAIKAAVKDYEAKRAKVGDATGAAPVEKVADA 113 SMLAEDAIKAAVKD EAKRAK+ ++ AAPVEK ADA Sbjct: 135 SMLAEDAIKAAVKDVEAKRAKLNGSSDAAPVEKAADA 171 >ref|XP_007029235.1| SufE/NifU family protein isoform 2 [Theobroma cacao] gi|508717840|gb|EOY09737.1| SufE/NifU family protein isoform 2 [Theobroma cacao] Length = 170 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 3 SMLAEDAIKAAVKDYEAKRAKVGDATGAAPVEKVADA 113 SMLAEDAIKAAVKD EAKRAK+ ++ AAP+EK ADA Sbjct: 134 SMLAEDAIKAAVKDVEAKRAKLNGSSNAAPIEKAADA 170 >ref|XP_007029234.1| SufE/NifU family protein isoform 1 [Theobroma cacao] gi|508717839|gb|EOY09736.1| SufE/NifU family protein isoform 1 [Theobroma cacao] Length = 197 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 3 SMLAEDAIKAAVKDYEAKRAKVGDATGAAPVEKVADA 113 SMLAEDAIKAAVKD EAKRAK+ ++ AAP+EK ADA Sbjct: 161 SMLAEDAIKAAVKDVEAKRAKLNGSSNAAPIEKAADA 197 >ref|XP_006476786.1| PREDICTED: iron-sulfur cluster assembly protein 1-like [Citrus sinensis] Length = 174 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +3 Query: 3 SMLAEDAIKAAVKDYEAKRAKVGDATGAAPVEKVADA 113 SMLAEDAIKAAVKDYEAKR K A+ AAP EK ADA Sbjct: 138 SMLAEDAIKAAVKDYEAKRTKSSAASEAAPAEKAADA 174