BLASTX nr result
ID: Sinomenium22_contig00004626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00004626 (527 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275815.1| PREDICTED: 60S ribosomal protein L29-1 [Viti... 121 9e-26 gb|ADV02780.1| putative 60S ribosomal protein L29 [Ipomoea batatas] 120 2e-25 gb|EXB55735.1| 60S ribosomal protein L29-1 [Morus notabilis] 120 2e-25 ref|XP_002276776.1| PREDICTED: 60S ribosomal protein L29-1 [Viti... 119 3e-25 ref|XP_007035751.1| Ribosomal L29e protein family [Theobroma cac... 119 4e-25 ref|XP_003609753.1| 60S ribosomal protein L29 [Medicago truncatu... 119 4e-25 dbj|BAA96072.1| ribosomal protein L29 [Panax ginseng] 119 6e-25 ref|XP_004499658.1| PREDICTED: 60S ribosomal protein L29-1-like ... 118 1e-24 ref|XP_003529537.1| PREDICTED: 60S ribosomal protein L29-1-like ... 118 1e-24 ref|XP_006597712.1| PREDICTED: 60S ribosomal protein L29-1 [Glyc... 117 2e-24 ref|XP_007138981.1| hypothetical protein PHAVU_009G254800g [Phas... 116 3e-24 ref|XP_006829382.1| hypothetical protein AMTR_s03807p00002720 [A... 116 3e-24 ref|XP_006444476.1| hypothetical protein CICLE_v10023233mg [Citr... 116 4e-24 ref|XP_002312342.1| 60S ribosomal protein L29 [Populus trichocar... 116 4e-24 ref|XP_004508161.1| PREDICTED: 60S ribosomal protein L29-1-like ... 115 5e-24 ref|XP_006419418.1| hypothetical protein CICLE_v10006499mg, part... 115 6e-24 ref|XP_004173787.1| PREDICTED: 60S ribosomal protein L29-1-like,... 115 6e-24 ref|XP_002519200.1| 60S ribosomal protein L29, putative [Ricinus... 115 8e-24 gb|AFK48186.1| unknown [Lotus japonicus] 114 1e-23 ref|XP_002314927.2| hypothetical protein POPTR_0010s15190g, part... 114 2e-23 >ref|XP_002275815.1| PREDICTED: 60S ribosomal protein L29-1 [Vitis vinifera] gi|147811184|emb|CAN63474.1| hypothetical protein VITISV_016797 [Vitis vinifera] gi|297743968|emb|CBI36938.3| unnamed protein product [Vitis vinifera] Length = 62 Score = 121 bits (304), Expect = 9e-26 Identities = 56/61 (91%), Positives = 57/61 (93%) Frame = +3 Query: 99 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSGTEN 278 MAKSKNHTAHNQS+KAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHN KS GS TE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNKKSEGSATEE 60 Query: 279 E 281 E Sbjct: 61 E 61 >gb|ADV02780.1| putative 60S ribosomal protein L29 [Ipomoea batatas] Length = 61 Score = 120 bits (302), Expect = 2e-25 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = +3 Query: 99 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSGTEN 278 MAKSKNHTAHNQS+KAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSG +G+ Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGEAGSGE 60 Query: 279 E 281 E Sbjct: 61 E 61 >gb|EXB55735.1| 60S ribosomal protein L29-1 [Morus notabilis] Length = 61 Score = 120 bits (301), Expect = 2e-25 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = +3 Query: 99 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSGTEN 278 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNN+ SG+E Sbjct: 1 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNQKNQSGSEQ 60 Query: 279 E 281 E Sbjct: 61 E 61 >ref|XP_002276776.1| PREDICTED: 60S ribosomal protein L29-1 [Vitis vinifera] gi|147802163|emb|CAN65958.1| hypothetical protein VITISV_007494 [Vitis vinifera] gi|296083268|emb|CBI22904.3| unnamed protein product [Vitis vinifera] Length = 61 Score = 119 bits (299), Expect = 3e-25 Identities = 55/61 (90%), Positives = 56/61 (91%) Frame = +3 Query: 99 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSGTEN 278 MAKSKNHTAHNQS+KAHKNGIKKPRKHRH STKGMDPKFLRNQRYARKHN KSG S TE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHASTKGMDPKFLRNQRYARKHNKKSGESATEE 60 Query: 279 E 281 E Sbjct: 61 E 61 >ref|XP_007035751.1| Ribosomal L29e protein family [Theobroma cacao] gi|508714780|gb|EOY06677.1| Ribosomal L29e protein family [Theobroma cacao] Length = 61 Score = 119 bits (298), Expect = 4e-25 Identities = 54/61 (88%), Positives = 57/61 (93%) Frame = +3 Query: 99 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSGTEN 278 MAKSKNHTAHNQS+KAHKNGIKKP++HRHTSTKGMDPKFLRNQRYARKHN KSG S TE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGESATEE 60 Query: 279 E 281 E Sbjct: 61 E 61 >ref|XP_003609753.1| 60S ribosomal protein L29 [Medicago truncatula] gi|355510808|gb|AES91950.1| 60S ribosomal protein L29 [Medicago truncatula] Length = 445 Score = 119 bits (298), Expect = 4e-25 Identities = 54/64 (84%), Positives = 58/64 (90%) Frame = +3 Query: 90 LREMAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSG 269 L EMAKSKNHTAHNQS+KAHKNGIKKP++HRHTSTKGMDPKFLRNQRYARKHN K+G Sbjct: 382 LNEMAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKNGEIA 441 Query: 270 TENE 281 TE E Sbjct: 442 TEEE 445 Score = 118 bits (296), Expect = 7e-25 Identities = 54/65 (83%), Positives = 60/65 (92%) Frame = +3 Query: 66 NKSSSSPSLREMAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKH 245 N SS++ S EMAKSKNHTAHNQS+KAHKNGIKKP++HRHTSTKGMDPKFLRNQRYARKH Sbjct: 126 NPSSTASSELEMAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKH 185 Query: 246 NNKSG 260 N K+G Sbjct: 186 NKKNG 190 >dbj|BAA96072.1| ribosomal protein L29 [Panax ginseng] Length = 61 Score = 119 bits (297), Expect = 6e-25 Identities = 54/61 (88%), Positives = 57/61 (93%) Frame = +3 Query: 99 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSGTEN 278 MAKSKNHTAHNQS KAH+NGIKKPRKHRHTST+GMDPKFLRNQRYARKHNNK+G S TE Sbjct: 1 MAKSKNHTAHNQSHKAHRNGIKKPRKHRHTSTRGMDPKFLRNQRYARKHNNKTGESATEE 60 Query: 279 E 281 E Sbjct: 61 E 61 >ref|XP_004499658.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X1 [Cicer arietinum] gi|502127331|ref|XP_004499659.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X2 [Cicer arietinum] Length = 61 Score = 118 bits (295), Expect = 1e-24 Identities = 53/61 (86%), Positives = 57/61 (93%) Frame = +3 Query: 99 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSGTEN 278 MAKSKNHTAHNQS+KAHKNGIKKP++HRHTSTKGMDPKFLRNQRYARKHNNK+G TE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNNKNGEIATEE 60 Query: 279 E 281 E Sbjct: 61 E 61 >ref|XP_003529537.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] gi|356529227|ref|XP_003533197.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] gi|356564681|ref|XP_003550578.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] Length = 61 Score = 118 bits (295), Expect = 1e-24 Identities = 53/61 (86%), Positives = 57/61 (93%) Frame = +3 Query: 99 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSGTEN 278 MAKSKNHTAHNQS+KAHKNGIKKP++HRHTSTKGMDPKFLRNQRYARKHN KSG + TE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGETATEE 60 Query: 279 E 281 E Sbjct: 61 E 61 >ref|XP_006597712.1| PREDICTED: 60S ribosomal protein L29-1 [Glycine max] Length = 61 Score = 117 bits (292), Expect = 2e-24 Identities = 53/61 (86%), Positives = 56/61 (91%) Frame = +3 Query: 99 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSGTEN 278 MAKSKNHTAHNQS+KAHKNGIKKP++HRHTSTKGMDPKFLRNQRYARKHN KSG TE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGEIATEE 60 Query: 279 E 281 E Sbjct: 61 E 61 >ref|XP_007138981.1| hypothetical protein PHAVU_009G254800g [Phaseolus vulgaris] gi|593782635|ref|XP_007154358.1| hypothetical protein PHAVU_003G112200g [Phaseolus vulgaris] gi|561012068|gb|ESW10975.1| hypothetical protein PHAVU_009G254800g [Phaseolus vulgaris] gi|561027712|gb|ESW26352.1| hypothetical protein PHAVU_003G112200g [Phaseolus vulgaris] Length = 61 Score = 116 bits (291), Expect = 3e-24 Identities = 52/61 (85%), Positives = 57/61 (93%) Frame = +3 Query: 99 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSGTEN 278 MAKSKNHTAHNQS+KAHKNGIKKP++HRHTSTKGMDPKFLRNQRYARKHN KSG + +E Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGETASEE 60 Query: 279 E 281 E Sbjct: 61 E 61 >ref|XP_006829382.1| hypothetical protein AMTR_s03807p00002720 [Amborella trichopoda] gi|586684495|ref|XP_006841420.1| hypothetical protein AMTR_s00003p00034600 [Amborella trichopoda] gi|548834679|gb|ERM96798.1| hypothetical protein AMTR_s03807p00002720 [Amborella trichopoda] gi|548843441|gb|ERN03095.1| hypothetical protein AMTR_s00003p00034600 [Amborella trichopoda] Length = 62 Score = 116 bits (291), Expect = 3e-24 Identities = 53/62 (85%), Positives = 56/62 (90%) Frame = +3 Query: 99 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSGTEN 278 MAKSKNHTAHNQS+KAHKNGIKKPR+ RHTSTKGMDPKFLRNQRYARKHN +G S TE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRRQRHTSTKGMDPKFLRNQRYARKHNKPNGASATEE 60 Query: 279 EE 284 EE Sbjct: 61 EE 62 >ref|XP_006444476.1| hypothetical protein CICLE_v10023233mg [Citrus clementina] gi|567903978|ref|XP_006444477.1| hypothetical protein CICLE_v10023233mg [Citrus clementina] gi|568878696|ref|XP_006492322.1| PREDICTED: 60S ribosomal protein L29-2-like [Citrus sinensis] gi|557546738|gb|ESR57716.1| hypothetical protein CICLE_v10023233mg [Citrus clementina] gi|557546739|gb|ESR57717.1| hypothetical protein CICLE_v10023233mg [Citrus clementina] Length = 60 Score = 116 bits (290), Expect = 4e-24 Identities = 52/59 (88%), Positives = 55/59 (93%) Frame = +3 Query: 99 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSGTE 275 MAKSKNHTAHNQS+KAHKNGIKKP+KHRHTSTKGMDPKFLRNQRYARKHN +GGS E Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKSNGGSAEE 59 >ref|XP_002312342.1| 60S ribosomal protein L29 [Populus trichocarpa] gi|118484518|gb|ABK94134.1| unknown [Populus trichocarpa] gi|222852162|gb|EEE89709.1| 60S ribosomal protein L29 [Populus trichocarpa] Length = 61 Score = 116 bits (290), Expect = 4e-24 Identities = 53/61 (86%), Positives = 55/61 (90%) Frame = +3 Query: 99 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSGTEN 278 MAKSKNHTAHNQS KAHKNGIKKP++HRHTSTKGMDPKFLRNQRYARKHN K G S TE Sbjct: 1 MAKSKNHTAHNQSHKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKCGDSATEE 60 Query: 279 E 281 E Sbjct: 61 E 61 >ref|XP_004508161.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X1 [Cicer arietinum] gi|502150865|ref|XP_004508162.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X2 [Cicer arietinum] gi|388515093|gb|AFK45608.1| unknown [Medicago truncatula] Length = 61 Score = 115 bits (289), Expect = 5e-24 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = +3 Query: 99 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSGTEN 278 MAKSKNHTAHNQS+KAHKNGIKKP++HRHTSTKGMDPKFLRNQRYARKHN K+G TE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKNGEIATEE 60 Query: 279 E 281 E Sbjct: 61 E 61 >ref|XP_006419418.1| hypothetical protein CICLE_v10006499mg, partial [Citrus clementina] gi|557521291|gb|ESR32658.1| hypothetical protein CICLE_v10006499mg, partial [Citrus clementina] Length = 88 Score = 115 bits (288), Expect = 6e-24 Identities = 52/60 (86%), Positives = 55/60 (91%) Frame = +3 Query: 96 EMAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSGTE 275 EMAKSKNHTAHNQS+KAHKNGIKKP+KHRHTSTKGMDPKFLRNQRYARKHN + G S E Sbjct: 28 EMAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQGGESAAE 87 >ref|XP_004173787.1| PREDICTED: 60S ribosomal protein L29-1-like, partial [Cucumis sativus] Length = 85 Score = 115 bits (288), Expect = 6e-24 Identities = 53/62 (85%), Positives = 56/62 (90%) Frame = +3 Query: 96 EMAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSGTE 275 EMAKSKNHTAHNQS KAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYA+KHN KSG + + Sbjct: 24 EMAKSKNHTAHNQSHKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYAKKHNTKSGENASG 83 Query: 276 NE 281 E Sbjct: 84 EE 85 >ref|XP_002519200.1| 60S ribosomal protein L29, putative [Ricinus communis] gi|223541515|gb|EEF43064.1| 60S ribosomal protein L29, putative [Ricinus communis] Length = 61 Score = 115 bits (287), Expect = 8e-24 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = +3 Query: 99 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSGTEN 278 MAKSKNHTAHNQS+KAHKNGIKKP++ RHTSTKGMDPKFLRNQRYARKHN KSG + TE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRQRHTSTKGMDPKFLRNQRYARKHNKKSGETATEE 60 Query: 279 E 281 E Sbjct: 61 E 61 >gb|AFK48186.1| unknown [Lotus japonicus] Length = 61 Score = 114 bits (285), Expect = 1e-23 Identities = 52/61 (85%), Positives = 55/61 (90%) Frame = +3 Query: 99 MAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGSGTEN 278 MAKSKNHTAHNQS+KAHKNGIKKP++HRHTSTKGMDPKFLRNQRYARKHN K S TE Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKGAESVTEE 60 Query: 279 E 281 E Sbjct: 61 E 61 >ref|XP_002314927.2| hypothetical protein POPTR_0010s15190g, partial [Populus trichocarpa] gi|550329855|gb|EEF01098.2| hypothetical protein POPTR_0010s15190g, partial [Populus trichocarpa] Length = 108 Score = 114 bits (284), Expect = 2e-23 Identities = 52/65 (80%), Positives = 57/65 (87%) Frame = +3 Query: 87 SLREMAKSKNHTAHNQSFKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNKSGGS 266 S+ EMAKSKNHTAHNQS KAH+NGIKKP++HRHTSTKGMDPKFLRNQRYARKHN K + Sbjct: 44 SVAEMAKSKNHTAHNQSHKAHQNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKCDET 103 Query: 267 GTENE 281 TE E Sbjct: 104 ATEEE 108