BLASTX nr result
ID: Sinomenium22_contig00003372
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00003372 (688 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15490.3| unnamed protein product [Vitis vinifera] 66 9e-09 ref|XP_002279248.1| PREDICTED: uncharacterized protein LOC100244... 66 9e-09 ref|XP_004512895.1| PREDICTED: uncharacterized protein LOC101491... 62 2e-07 ref|XP_006855349.1| hypothetical protein AMTR_s00057p00105740 [A... 61 4e-07 ref|XP_003620403.1| hypothetical protein MTR_6g082450 [Medicago ... 60 5e-07 ref|XP_006468749.1| PREDICTED: uncharacterized protein LOC102606... 60 9e-07 ref|XP_003534161.1| PREDICTED: uncharacterized protein LOC100775... 59 1e-06 ref|XP_006480020.1| PREDICTED: uncharacterized protein LOC102619... 59 2e-06 ref|XP_006480019.1| PREDICTED: uncharacterized protein LOC102619... 59 2e-06 ref|XP_007051024.1| Uncharacterized protein TCM_004737 [Theobrom... 59 2e-06 ref|XP_006448410.1| hypothetical protein CICLE_v10015520mg [Citr... 59 2e-06 ref|XP_002527022.1| conserved hypothetical protein [Ricinus comm... 58 3e-06 gb|EXB95724.1| hypothetical protein L484_007474 [Morus notabilis] 58 3e-06 ref|XP_004295114.1| PREDICTED: uncharacterized protein LOC101293... 58 3e-06 ref|XP_002279807.2| PREDICTED: uncharacterized protein LOC100256... 57 4e-06 emb|CAN76986.1| hypothetical protein VITISV_027947 [Vitis vinifera] 57 4e-06 ref|XP_006444428.1| hypothetical protein CICLE_v10020424mg [Citr... 57 6e-06 ref|XP_006444427.1| hypothetical protein CICLE_v10020424mg [Citr... 57 6e-06 ref|XP_006444426.1| hypothetical protein CICLE_v10020424mg [Citr... 57 6e-06 ref|XP_006444425.1| hypothetical protein CICLE_v10020424mg [Citr... 57 6e-06 >emb|CBI15490.3| unnamed protein product [Vitis vinifera] Length = 367 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 685 SGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFFVSHGACRR 563 +G CE Q NSL+QAADNRLRLL+V+HPDFQFFVSHG RR Sbjct: 327 NGTCEHQRVNSLVQAADNRLRLLEVNHPDFQFFVSHGMYRR 367 >ref|XP_002279248.1| PREDICTED: uncharacterized protein LOC100244012 [Vitis vinifera] Length = 409 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 685 SGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFFVSHGACRR 563 +G CE Q NSL+QAADNRLRLL+V+HPDFQFFVSHG RR Sbjct: 369 NGTCEHQRVNSLVQAADNRLRLLEVNHPDFQFFVSHGMYRR 409 >ref|XP_004512895.1| PREDICTED: uncharacterized protein LOC101491315 [Cicer arietinum] Length = 365 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 685 SGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFFVSHG 575 +G + QLSNSLLQAADN LRL+QVHHPD+QFFVSHG Sbjct: 327 NGVSDNQLSNSLLQAADNWLRLVQVHHPDYQFFVSHG 363 >ref|XP_006855349.1| hypothetical protein AMTR_s00057p00105740 [Amborella trichopoda] gi|548859115|gb|ERN16816.1| hypothetical protein AMTR_s00057p00105740 [Amborella trichopoda] Length = 267 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 688 PSGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFFVSH 578 P+G CE QL++SLLQAADN +RLLQV HPDF+FF+SH Sbjct: 226 PNGVCERQLASSLLQAADNWIRLLQVEHPDFRFFISH 262 >ref|XP_003620403.1| hypothetical protein MTR_6g082450 [Medicago truncatula] gi|355495418|gb|AES76621.1| hypothetical protein MTR_6g082450 [Medicago truncatula] Length = 441 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 667 QLSNSLLQAADNRLRLLQVHHPDFQFFVSHGACRR 563 QL+NSLLQAADN LRL+QV+HPD+QFFVSHG RR Sbjct: 407 QLANSLLQAADNWLRLVQVNHPDYQFFVSHGTYRR 441 >ref|XP_006468749.1| PREDICTED: uncharacterized protein LOC102606915 [Citrus sinensis] Length = 394 Score = 59.7 bits (143), Expect = 9e-07 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 688 PSGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFFVSHGACRR 563 P+GGCE QL++SLLQAADN LRLLQV+HPDF FF CRR Sbjct: 358 PTGGCERQLASSLLQAADNWLRLLQVNHPDFLFF-----CRR 394 >ref|XP_003534161.1| PREDICTED: uncharacterized protein LOC100775751 [Glycine max] Length = 410 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 685 SGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFFVSHGACRR 563 +G E Q+ NSLLQAADN LRLLQV+HPD+QFFVSHG R Sbjct: 370 NGVSESQVVNSLLQAADNWLRLLQVNHPDYQFFVSHGTYNR 410 >ref|XP_006480020.1| PREDICTED: uncharacterized protein LOC102619406 isoform X2 [Citrus sinensis] Length = 403 Score = 58.9 bits (141), Expect = 2e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 688 PSGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFFVSHGA 572 P+G EWQ +NSLLQAADN LR LQV+ PDFQFFVSH + Sbjct: 362 PNGANEWQQANSLLQAADNWLRGLQVYLPDFQFFVSHSS 400 >ref|XP_006480019.1| PREDICTED: uncharacterized protein LOC102619406 isoform X1 [Citrus sinensis] Length = 404 Score = 58.9 bits (141), Expect = 2e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 688 PSGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFFVSHGA 572 P+G EWQ +NSLLQAADN LR LQV+ PDFQFFVSH + Sbjct: 363 PNGANEWQQANSLLQAADNWLRGLQVYLPDFQFFVSHSS 401 >ref|XP_007051024.1| Uncharacterized protein TCM_004737 [Theobroma cacao] gi|508703285|gb|EOX95181.1| Uncharacterized protein TCM_004737 [Theobroma cacao] Length = 396 Score = 58.9 bits (141), Expect = 2e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 688 PSGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFFVSH 578 P+G EWQ ++SLLQAADN LR LQVH PDFQFFVSH Sbjct: 359 PNGSQEWQQASSLLQAADNWLRGLQVHLPDFQFFVSH 395 >ref|XP_006448410.1| hypothetical protein CICLE_v10015520mg [Citrus clementina] gi|557551021|gb|ESR61650.1| hypothetical protein CICLE_v10015520mg [Citrus clementina] Length = 394 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 688 PSGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFF 587 P+GGCE QL++SLLQAADN LRLLQV+HPDF FF Sbjct: 358 PTGGCERQLASSLLQAADNWLRLLQVNHPDFLFF 391 >ref|XP_002527022.1| conserved hypothetical protein [Ricinus communis] gi|223533657|gb|EEF35394.1| conserved hypothetical protein [Ricinus communis] Length = 419 Score = 58.2 bits (139), Expect = 3e-06 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -1 Query: 688 PSGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFFVSHGACRR 563 PSGG E QL+NSLLQAADN LRL+QV+HPDF FF CRR Sbjct: 383 PSGGSERQLANSLLQAADNWLRLVQVYHPDFVFF-----CRR 419 >gb|EXB95724.1| hypothetical protein L484_007474 [Morus notabilis] Length = 411 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -1 Query: 688 PSGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFFVSHGA 572 PSG EWQ +NSLLQAADN L+ LQV+ PDFQFF+SH + Sbjct: 370 PSGPHEWQQANSLLQAADNWLQRLQVNLPDFQFFISHNS 408 >ref|XP_004295114.1| PREDICTED: uncharacterized protein LOC101293279 [Fragaria vesca subsp. vesca] Length = 406 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -1 Query: 688 PSGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFFVSHGACRR 563 P+G E Q +NSLL+AA+N LRLL VHHPDF FFVSH RR Sbjct: 365 PNGVYESQKANSLLRAAENWLRLLHVHHPDFNFFVSHNTPRR 406 >ref|XP_002279807.2| PREDICTED: uncharacterized protein LOC100256001 [Vitis vinifera] gi|297737778|emb|CBI26979.3| unnamed protein product [Vitis vinifera] Length = 383 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -1 Query: 688 PSGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFFVSHGACRR 563 P+GG + QL+NSLLQAAD+RLRLLQV+HPDF FF CRR Sbjct: 347 PNGGRDCQLTNSLLQAADDRLRLLQVNHPDFLFF-----CRR 383 >emb|CAN76986.1| hypothetical protein VITISV_027947 [Vitis vinifera] Length = 447 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -1 Query: 688 PSGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFFVSHGACRR 563 P+GG + QL+NSLLQAAD+RLRLLQV+HPDF FF CRR Sbjct: 411 PNGGRDCQLTNSLLQAADDRLRLLQVNHPDFLFF-----CRR 447 >ref|XP_006444428.1| hypothetical protein CICLE_v10020424mg [Citrus clementina] gi|557546690|gb|ESR57668.1| hypothetical protein CICLE_v10020424mg [Citrus clementina] Length = 335 Score = 57.0 bits (136), Expect = 6e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -1 Query: 688 PSGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFFVSHGA 572 P+G EWQ +NSLLQAAD+ LR LQV+ PDFQFFVSH + Sbjct: 294 PNGANEWQQANSLLQAADDWLRGLQVYLPDFQFFVSHSS 332 >ref|XP_006444427.1| hypothetical protein CICLE_v10020424mg [Citrus clementina] gi|557546689|gb|ESR57667.1| hypothetical protein CICLE_v10020424mg [Citrus clementina] Length = 404 Score = 57.0 bits (136), Expect = 6e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -1 Query: 688 PSGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFFVSHGA 572 P+G EWQ +NSLLQAAD+ LR LQV+ PDFQFFVSH + Sbjct: 363 PNGANEWQQANSLLQAADDWLRGLQVYLPDFQFFVSHSS 401 >ref|XP_006444426.1| hypothetical protein CICLE_v10020424mg [Citrus clementina] gi|557546688|gb|ESR57666.1| hypothetical protein CICLE_v10020424mg [Citrus clementina] Length = 403 Score = 57.0 bits (136), Expect = 6e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -1 Query: 688 PSGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFFVSHGA 572 P+G EWQ +NSLLQAAD+ LR LQV+ PDFQFFVSH + Sbjct: 362 PNGANEWQQANSLLQAADDWLRGLQVYLPDFQFFVSHSS 400 >ref|XP_006444425.1| hypothetical protein CICLE_v10020424mg [Citrus clementina] gi|557546687|gb|ESR57665.1| hypothetical protein CICLE_v10020424mg [Citrus clementina] Length = 398 Score = 57.0 bits (136), Expect = 6e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -1 Query: 688 PSGGCEWQLSNSLLQAADNRLRLLQVHHPDFQFFVSHGA 572 P+G EWQ +NSLLQAAD+ LR LQV+ PDFQFFVSH + Sbjct: 357 PNGANEWQQANSLLQAADDWLRGLQVYLPDFQFFVSHSS 395