BLASTX nr result
ID: Sinomenium22_contig00003362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00003362 (672 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004495206.1| PREDICTED: pentatricopeptide repeat-containi... 63 1e-07 ref|XP_007050629.1| Pentatricopeptide repeat (PPR) superfamily p... 59 1e-06 ref|XP_002279399.2| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 emb|CBI26594.3| unnamed protein product [Vitis vinifera] 59 2e-06 ref|XP_007198989.1| hypothetical protein PRUPE_ppa004422mg [Prun... 58 3e-06 ref|XP_003536907.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_007144631.1| hypothetical protein PHAVU_007G171700g [Phas... 56 9e-06 >ref|XP_004495206.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial-like [Cicer arietinum] Length = 510 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -1 Query: 672 KMPLIVAEHMNKDTVQLDEESHRLTKLTSKLCVGEVSSVLS 550 KMPLIV E M KD VQLDEE+HRL LTSK+CVG+VS LS Sbjct: 470 KMPLIVTERMKKDNVQLDEETHRLLDLTSKMCVGDVSGFLS 510 >ref|XP_007050629.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508702890|gb|EOX94786.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 513 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = -1 Query: 672 KMPLIVAEHMNKDTVQLDEESHRLTKLTSKLCVGEVSSVL 553 KMPLIVAE M KD V LDEE+H L LTSK+CV EVSS L Sbjct: 474 KMPLIVAERMRKDNVPLDEETHELINLTSKMCVSEVSSSL 513 >ref|XP_002279399.2| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial-like [Vitis vinifera] Length = 642 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -1 Query: 672 KMPLIVAEHMNKDTVQLDEESHRLTKLTSKLCVGEVSS 559 KMPLIVAE M KD V++DEE+HRL K TSK+CV EVSS Sbjct: 600 KMPLIVAEWMKKDKVEMDEETHRLIKETSKMCVSEVSS 637 >emb|CBI26594.3| unnamed protein product [Vitis vinifera] Length = 529 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -1 Query: 672 KMPLIVAEHMNKDTVQLDEESHRLTKLTSKLCVGEVSS 559 KMPLIVAE M KD V++DEE+HRL K TSK+CV EVSS Sbjct: 487 KMPLIVAEWMKKDKVEMDEETHRLIKETSKMCVSEVSS 524 >ref|XP_007198989.1| hypothetical protein PRUPE_ppa004422mg [Prunus persica] gi|462394389|gb|EMJ00188.1| hypothetical protein PRUPE_ppa004422mg [Prunus persica] Length = 511 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -1 Query: 672 KMPLIVAEHMNKDTVQLDEESHRLTKLTSKLCVGEVSSVLS 550 KMPLIVAE M KD VQLDEE+ RL KLTS +CV EV ++ S Sbjct: 471 KMPLIVAERMEKDNVQLDEETRRLIKLTSTMCVSEVPNIRS 511 >ref|XP_003536907.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial-like [Glycine max] Length = 516 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -1 Query: 672 KMPLIVAEHMNKDTVQLDEESHRLTKLTSKLCVGEVSSVLS 550 KMP+IVAE M KD V+LDEE+ RL LTSK+CV +VS +LS Sbjct: 476 KMPMIVAERMRKDNVKLDEETRRLLDLTSKMCVSDVSRILS 516 >ref|XP_007144631.1| hypothetical protein PHAVU_007G171700g [Phaseolus vulgaris] gi|561017821|gb|ESW16625.1| hypothetical protein PHAVU_007G171700g [Phaseolus vulgaris] Length = 511 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -1 Query: 672 KMPLIVAEHMNKDTVQLDEESHRLTKLTSKLCVGEVSSVLS 550 KMPLIVAE M KD V+LDEE+ RL LTSK+CV +VS + S Sbjct: 471 KMPLIVAERMRKDNVKLDEETQRLLDLTSKMCVSDVSRISS 511