BLASTX nr result
ID: Sinomenium22_contig00003298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00003298 (1088 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268058.1| PREDICTED: transcription factor TCP7-like [V... 62 5e-07 >ref|XP_002268058.1| PREDICTED: transcription factor TCP7-like [Vitis vinifera] Length = 255 Score = 61.6 bits (148), Expect = 5e-07 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 784 PTMASQGSMSGRFGGQQPMGEASAARVGNYLPMAQGH 674 PTMASQ ++SGRF QQPMGEASAARVGNYLP+AQGH Sbjct: 198 PTMASQPTISGRFM-QQPMGEASAARVGNYLPIAQGH 233