BLASTX nr result
ID: Sinomenium22_contig00003122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00003122 (354 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS58462.1| hypothetical protein TRIUR3_26054 [Triticum urartu] 55 8e-06 >gb|EMS58462.1| hypothetical protein TRIUR3_26054 [Triticum urartu] Length = 1206 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/50 (54%), Positives = 36/50 (72%) Frame = +3 Query: 30 SVEGHDNLGVTNENKFFRRISMLEVKNALRKIKNAKALGPDAIPIEVWKG 179 ++E D+ G T+ +F RRI EVK AL+++K KA+GPD IPIEVWKG Sbjct: 158 TIELDDSFGETSM-RFVRRIQESEVKEALKRMKGGKAMGPDCIPIEVWKG 206