BLASTX nr result
ID: Sinomenium22_contig00002907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00002907 (1387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGZ19167.1| clp protease proteolytic subunit (chloroplast) [C... 83 3e-13 ref|YP_008520164.1| clpP-like protease (chloroplast) [Camellia t... 83 3e-13 ref|YP_008592782.1| clpP-like protease (chloroplast) [Camellia c... 83 3e-13 gb|AEZ48943.1| clp protease proteolytic subunit, partial [Trades... 79 6e-12 ref|YP_008081290.1| Clp protease proteolytic subunit (chloroplas... 75 9e-11 gb|AEX96572.1| clp protease proteolytic subunit (chloroplast) [C... 72 4e-10 gb|AEX96545.1| clp protease proteolytic subunit (chloroplast) [H... 72 4e-10 ref|YP_008815142.1| clp protease proteolytic subunit (chloroplas... 70 2e-09 ref|YP_001671708.1| ATP-dependent Clp protease proteolytic subun... 70 2e-09 gb|AGM14961.1| ATP-dependent Clp protease proteolytic subunit (c... 70 2e-09 ref|YP_008814881.1| clp protease proteolytic subunit (chloroplas... 70 2e-09 gb|AAZ03802.1| ATP-depedent Clp protease proteolytic subunit [Ra... 70 2e-09 gb|AAZ03799.1| ATP-depedent Clp protease proteolytic subunit [Ac... 70 2e-09 ref|YP_319788.1| ATP-dependent Clp protease proteolytic subunit ... 70 2e-09 sp|Q5QA83.1|CLPP_ACOGR RecName: Full=ATP-dependent Clp protease ... 70 2e-09 ref|YP_086990.1| ATP-dependent Clp protease proteolytic subunit ... 70 2e-09 ref|NP_054525.1| ATP-dependent Clp protease proteolytic subunit ... 70 2e-09 gb|AEX96570.1| clp protease proteolytic subunit (chloroplast) [O... 70 2e-09 ref|YP_002836115.1| clp protease proteolytic subunit [Megalerant... 70 2e-09 ref|YP_001004211.1| clp protease proteolytic subunit [Ranunculus... 70 2e-09 >gb|AGZ19167.1| clp protease proteolytic subunit (chloroplast) [Camellia sinensis] Length = 214 Score = 83.2 bits (204), Expect = 3e-13 Identities = 40/54 (74%), Positives = 48/54 (88%), Gaps = 1/54 (1%) Frame = +3 Query: 363 FSNQVEVHD-LICYIIRVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYV 521 F++ E+ + L+CYIIRVMIHQPASSFYEAQ GEF++EA+ELLKL ETLTRVYV Sbjct: 124 FTSSYEIEEPLLCYIIRVMIHQPASSFYEAQTGEFILEAEELLKLRETLTRVYV 177 >ref|YP_008520164.1| clpP-like protease (chloroplast) [Camellia taliensis] gi|552540845|ref|YP_008592869.1| clpP-like protease (chloroplast) [Camellia danzaiensis] gi|552540938|ref|YP_008592958.1| clpP-like protease (chloroplast) [Camellia impressinervis] gi|552541032|ref|YP_008593136.1| clpP-like protease (chloroplast) [Camellia yunnanensis] gi|552546191|ref|YP_008593047.1| clpP-like protease (chloroplast) [Camellia pitardii] gi|537362504|gb|AGU44311.1| clpP-like protease (chloroplast) [Camellia danzaiensis] gi|537362592|gb|AGU44398.1| clpP-like protease (chloroplast) [Camellia impressinervis] gi|537362682|gb|AGU44487.1| clpP-like protease (chloroplast) [Camellia taliensis] gi|537362772|gb|AGU44576.1| clpP-like protease (chloroplast) [Camellia pitardii] gi|537362862|gb|AGU44665.1| clpP-like protease (chloroplast) [Camellia yunnanensis] gi|537362952|gb|AGU44754.1| clpP-like protease (chloroplast) [Camellia taliensis] Length = 214 Score = 83.2 bits (204), Expect = 3e-13 Identities = 40/54 (74%), Positives = 48/54 (88%), Gaps = 1/54 (1%) Frame = +3 Query: 363 FSNQVEVHD-LICYIIRVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYV 521 F++ E+ + L+CYIIRVMIHQPASSFYEAQ GEF++EA+ELLKL ETLTRVYV Sbjct: 124 FTSSYEIEEPLLCYIIRVMIHQPASSFYEAQTGEFILEAEELLKLRETLTRVYV 177 >ref|YP_008592782.1| clpP-like protease (chloroplast) [Camellia cuspidata] gi|537362414|gb|AGU44222.1| clpP-like protease (chloroplast) [Camellia cuspidata] Length = 214 Score = 83.2 bits (204), Expect = 3e-13 Identities = 40/54 (74%), Positives = 48/54 (88%), Gaps = 1/54 (1%) Frame = +3 Query: 363 FSNQVEVHD-LICYIIRVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYV 521 F++ E+ + L+CYIIRVMIHQPASSFYEAQ GEF++EA+ELLKL ETLTRVYV Sbjct: 124 FTSSYEIEEPLLCYIIRVMIHQPASSFYEAQTGEFILEAEELLKLRETLTRVYV 177 >gb|AEZ48943.1| clp protease proteolytic subunit, partial [Tradescantia ohiensis] Length = 201 Score = 78.6 bits (192), Expect = 6e-12 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = +3 Query: 384 HDLICYIIRVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYV 521 H ++ YIIRVMIHQPASSFYEAQ GEF++EA+ELLKL ETLTR+YV Sbjct: 119 HAMVFYIIRVMIHQPASSFYEAQAGEFILEAEELLKLRETLTRIYV 164 >ref|YP_008081290.1| Clp protease proteolytic subunit (chloroplast) [Catharanthus roseus] gi|474452101|gb|AGI51169.1| Clp protease proteolytic subunit (chloroplast) [Catharanthus roseus] Length = 202 Score = 74.7 bits (182), Expect = 9e-11 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 399 YIIRVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYV 521 YIIRVMIHQPASSFYEAQ GEF++EA+ELLK+ ETLTRVYV Sbjct: 125 YIIRVMIHQPASSFYEAQTGEFILEAEELLKMRETLTRVYV 165 >gb|AEX96572.1| clp protease proteolytic subunit (chloroplast) [Calibanus hookeri] Length = 210 Score = 72.4 bits (176), Expect = 4e-10 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +3 Query: 384 HDLICYIIRVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYV 521 H ++ IRVMIHQPASSFYEAQ GEF++EA+ELLKL ETLT+VYV Sbjct: 120 HAMLYQYIRVMIHQPASSFYEAQAGEFILEAEELLKLRETLTKVYV 165 >gb|AEX96545.1| clp protease proteolytic subunit (chloroplast) [Hosta ventricosa] Length = 211 Score = 72.4 bits (176), Expect = 4e-10 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +3 Query: 390 LICYIIRVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYV 521 +I IIRVMIHQPASSFYEAQ GEF++EA+ELLKL ETLT+VYV Sbjct: 123 VISNIIRVMIHQPASSFYEAQAGEFILEAEELLKLRETLTKVYV 166 >ref|YP_008815142.1| clp protease proteolytic subunit (chloroplast) [Schefflera delavayi] gi|458599548|gb|AGG39241.1| clp protease proteolytic subunit (chloroplast) [Schefflera delavayi] Length = 195 Score = 70.5 bits (171), Expect = 2e-09 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +3 Query: 408 RVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYVYSKSTNFF 545 RVMIHQPASSFYEAQ GEF++EA+ELLKL ETLTRVYV F+ Sbjct: 121 RVMIHQPASSFYEAQTGEFILEAEELLKLRETLTRVYVQKTGKPFW 166 >ref|YP_001671708.1| ATP-dependent Clp protease proteolytic subunit [Carica papaya] gi|166344158|gb|ABY86808.1| ATP-dependent Clp protease proteolytic subunit [Carica papaya] Length = 196 Score = 70.5 bits (171), Expect = 2e-09 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 408 RVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYV 521 RVMIHQPASSFYEAQ+GEF++EA+ELLKL ETLTRVYV Sbjct: 122 RVMIHQPASSFYEAQVGEFILEAEELLKLRETLTRVYV 159 >gb|AGM14961.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) [Panax ginseng] gi|506444487|gb|AGM15047.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) [Panax ginseng] gi|506444603|gb|AGM15133.1| ATP-dependent Clp protease proteolytic subunit (chloroplast) [Panax ginseng] Length = 195 Score = 70.1 bits (170), Expect = 2e-09 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +3 Query: 408 RVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYVYSKSTNFF 545 RVMIHQPASSFYEAQ GEFV+EA+ELLKL ET+TRVYV F+ Sbjct: 121 RVMIHQPASSFYEAQTGEFVLEAEELLKLRETITRVYVQKTGKPFW 166 >ref|YP_008814881.1| clp protease proteolytic subunit (chloroplast) [Aralia undulata] gi|458599114|gb|AGG38980.1| clp protease proteolytic subunit (chloroplast) [Aralia undulata] Length = 195 Score = 70.1 bits (170), Expect = 2e-09 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +3 Query: 408 RVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYVYSKSTNFF 545 RVMIHQPASSFYEAQ GEFV+EA+ELLKL ET+TRVYV F+ Sbjct: 121 RVMIHQPASSFYEAQTGEFVLEAEELLKLRETITRVYVQKTGKPFW 166 >gb|AAZ03802.1| ATP-depedent Clp protease proteolytic subunit [Ranunculus macranthus] Length = 195 Score = 70.1 bits (170), Expect = 2e-09 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 408 RVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYV 521 RVMIHQPASSFYEAQ GEFV+EA+ELLKL ETLTRVYV Sbjct: 121 RVMIHQPASSFYEAQTGEFVLEAEELLKLRETLTRVYV 158 >gb|AAZ03799.1| ATP-depedent Clp protease proteolytic subunit [Acorus americanus] Length = 195 Score = 70.1 bits (170), Expect = 2e-09 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 408 RVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYV 521 RVMIHQPASSFYEAQ GEFV+EA+ELLKL ETLTRVYV Sbjct: 121 RVMIHQPASSFYEAQAGEFVLEAEELLKLRETLTRVYV 158 >ref|YP_319788.1| ATP-dependent Clp protease proteolytic subunit [Acorus calamus] gi|161622334|ref|YP_001586206.1| ATP-dependent Clp protease proteolytic subunit [Acorus americanus] gi|122217404|sp|Q3V509.1|CLPP_ACOCL RecName: Full=ATP-dependent Clp protease proteolytic subunit; AltName: Full=Endopeptidase Clp gi|74381734|emb|CAI53819.1| ATP-dependent protease proteolytic subunit [Acorus calamus] gi|160369877|gb|ABX38768.1| clp protease proteolytic subunit [Acorus americanus] Length = 202 Score = 70.1 bits (170), Expect = 2e-09 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 408 RVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYV 521 RVMIHQPASSFYEAQ GEFV+EA+ELLKL ETLTRVYV Sbjct: 122 RVMIHQPASSFYEAQAGEFVLEAEELLKLRETLTRVYV 159 >sp|Q5QA83.1|CLPP_ACOGR RecName: Full=ATP-dependent Clp protease proteolytic subunit; AltName: Full=Endopeptidase Clp gi|56122453|gb|AAV74350.1| ClpP [Acorus gramineus] Length = 202 Score = 70.1 bits (170), Expect = 2e-09 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 408 RVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYV 521 RVMIHQPASSFYEAQ GEFV+EA+ELLKL ETLTRVYV Sbjct: 122 RVMIHQPASSFYEAQAGEFVLEAEELLKLRETLTRVYV 159 >ref|YP_086990.1| ATP-dependent Clp protease proteolytic subunit [Panax ginseng] gi|68052101|sp|Q68RY2.1|CLPP_PANGI RecName: Full=ATP-dependent Clp protease proteolytic subunit; AltName: Full=Endopeptidase Clp gi|51235337|gb|AAT98533.1| ATP-dependent protease; catalytic subunit [Panax ginseng] Length = 196 Score = 70.1 bits (170), Expect = 2e-09 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +3 Query: 408 RVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYVYSKSTNFF 545 RVMIHQPASSFYEAQ GEFV+EA+ELLKL ET+TRVYV F+ Sbjct: 122 RVMIHQPASSFYEAQTGEFVLEAEELLKLRETITRVYVQKTGKPFW 167 >ref|NP_054525.1| ATP-dependent Clp protease proteolytic subunit [Nicotiana tabacum] gi|78102563|ref|YP_358703.1| ATP-dependent Clp protease proteolytic subunit [Nicotiana sylvestris] gi|81301593|ref|YP_398889.1| ATP-dependent Clp protease proteolytic subunit [Nicotiana tomentosiformis] gi|351653910|ref|YP_004891632.1| clpP gene product (chloroplast) [Nicotiana undulata] gi|116527|sp|P12210.1|CLPP_TOBAC RecName: Full=ATP-dependent Clp protease proteolytic subunit; AltName: Full=Endopeptidase Clp gi|122212889|sp|Q33C07.1|CLPP_NICTO RecName: Full=ATP-dependent Clp protease proteolytic subunit; AltName: Full=Endopeptidase Clp gi|122213564|sp|Q3C1K4.1|CLPP_NICSY RecName: Full=ATP-dependent Clp protease proteolytic subunit; AltName: Full=Endopeptidase Clp gi|1143166|gb|AAA84867.1| ClpP protease [Nicotiana tabacum] gi|2924270|emb|CAA77422.1| ATP-dependent protease proteolytic subuni [Nicotiana tabacum] gi|77799590|dbj|BAE46679.1| ATP-dependent protease proteolytic subunit [Nicotiana sylvestris] gi|80750952|dbj|BAE48028.1| ATP-dependent protease proteolytic subunit [Nicotiana tomentosiformis] gi|347453936|gb|AEO95594.1| clp protease proteolytic subunit (chloroplast) [Nicotiana undulata] gi|347454047|gb|AEO95704.1| clp protease proteolytic subunit [synthetic construct] Length = 196 Score = 70.1 bits (170), Expect = 2e-09 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 408 RVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYV 521 RVMIHQPASSFYEAQ GEFV+EA+ELLKL ETLTRVYV Sbjct: 122 RVMIHQPASSFYEAQTGEFVLEAEELLKLRETLTRVYV 159 >gb|AEX96570.1| clp protease proteolytic subunit (chloroplast) [Oziroe biflora] Length = 204 Score = 70.1 bits (170), Expect = 2e-09 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +3 Query: 405 IRVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYV 521 +RVMIHQPASSFYEAQ GEFV+EA+ELLKL ETLT+VYV Sbjct: 121 VRVMIHQPASSFYEAQAGEFVLEAEELLKLRETLTKVYV 159 >ref|YP_002836115.1| clp protease proteolytic subunit [Megaleranthis saniculifolia] gi|226933907|gb|ACO92040.1| clp protease proteolytic subunit [Megaleranthis saniculifolia] Length = 201 Score = 70.1 bits (170), Expect = 2e-09 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 408 RVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYV 521 RVMIHQPASSFYEAQ GEFV+EA+ELLKL ETLTRVYV Sbjct: 121 RVMIHQPASSFYEAQTGEFVLEAEELLKLRETLTRVYV 158 >ref|YP_001004211.1| clp protease proteolytic subunit [Ranunculus macranthus] gi|160380563|sp|A1XGR3.1|CLPP_RANMC RecName: Full=ATP-dependent Clp protease proteolytic subunit; AltName: Full=Endopeptidase Clp gi|85540829|gb|ABC70781.1| clp protease proteolytic subunit [Ranunculus macranthus] Length = 201 Score = 70.1 bits (170), Expect = 2e-09 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 408 RVMIHQPASSFYEAQMGEFVMEAKELLKLHETLTRVYV 521 RVMIHQPASSFYEAQ GEFV+EA+ELLKL ETLTRVYV Sbjct: 121 RVMIHQPASSFYEAQTGEFVLEAEELLKLRETLTRVYV 158