BLASTX nr result
ID: Sinomenium22_contig00002635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00002635 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002325979.2| 17.5 kd heat shock family protein [Populus t... 64 3e-08 ref|NP_001235546.1| uncharacterized protein LOC100527912 [Glycin... 63 5e-08 ref|XP_006384657.1| 17.6 kDa class I small heat shock family pro... 62 6e-08 ref|XP_002325980.2| 17.5 kd heat shock family protein [Populus t... 62 6e-08 ref|XP_006387302.1| hypothetical protein POPTR_1310s00200g [Popu... 62 6e-08 ref|XP_002520483.1| heat-shock protein, putative [Ricinus commun... 62 6e-08 ref|XP_002520464.1| heat-shock protein, putative [Ricinus commun... 62 6e-08 ref|XP_007159139.1| hypothetical protein PHAVU_002G212000g [Phas... 62 8e-08 ref|XP_002520462.1| heat-shock protein, putative [Ricinus commun... 62 8e-08 ref|XP_002312132.1| 18.2 kDa class I heat shock family protein [... 62 8e-08 gb|AHI18144.1| 17.6 kDa class 1 small heat shock protein [Solanu... 62 1e-07 ref|XP_006480920.1| PREDICTED: 17.7 kDa class I heat shock prote... 62 1e-07 ref|XP_006350804.1| PREDICTED: 17.7 kDa class I heat shock prote... 62 1e-07 ref|XP_006350803.1| PREDICTED: 17.6 kDa class I heat shock prote... 62 1e-07 ref|XP_006350800.1| PREDICTED: 17.8 kDa class I heat shock prote... 62 1e-07 ref|XP_007159362.1| hypothetical protein PHAVU_002G231800g [Phas... 62 1e-07 ref|XP_007159358.1| hypothetical protein PHAVU_002G231400g [Phas... 62 1e-07 ref|XP_006429242.1| hypothetical protein CICLE_v10013046mg [Citr... 62 1e-07 ref|XP_004241201.1| PREDICTED: 17.7 kDa class I heat shock prote... 62 1e-07 ref|NP_001275610.1| 17.6 kDa class I heat shock protein-like [So... 62 1e-07 >ref|XP_002325979.2| 17.5 kd heat shock family protein [Populus trichocarpa] gi|550317260|gb|EEF00361.2| 17.5 kd heat shock family protein [Populus trichocarpa] Length = 152 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 351 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 259 SGKFLRRFRLPENAKVDQVKASMENGVLTVT Sbjct: 104 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 134 >ref|NP_001235546.1| uncharacterized protein LOC100527912 [Glycine max] gi|255633534|gb|ACU17125.1| unknown [Glycine max] Length = 153 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 351 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 259 SGKF+RRFRLPENAKVDQVKASMENGVLTVT Sbjct: 105 SGKFMRRFRLPENAKVDQVKASMENGVLTVT 135 >ref|XP_006384657.1| 17.6 kDa class I small heat shock family protein [Populus trichocarpa] gi|550341425|gb|ERP62454.1| 17.6 kDa class I small heat shock family protein [Populus trichocarpa] Length = 159 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 351 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 259 SGKFLRRFRLPENAK+DQVKASMENGVLTVT Sbjct: 111 SGKFLRRFRLPENAKMDQVKASMENGVLTVT 141 >ref|XP_002325980.2| 17.5 kd heat shock family protein [Populus trichocarpa] gi|550317261|gb|EEF00362.2| 17.5 kd heat shock family protein [Populus trichocarpa] Length = 152 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 351 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 259 SGKF+RRFRLPENAKVDQVKASMENGVLTVT Sbjct: 104 SGKFVRRFRLPENAKVDQVKASMENGVLTVT 134 >ref|XP_006387302.1| hypothetical protein POPTR_1310s00200g [Populus trichocarpa] gi|550306330|gb|ERP46216.1| hypothetical protein POPTR_1310s00200g [Populus trichocarpa] Length = 159 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 351 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 259 SGKFLRRFRLPENAK+DQVKASMENGVLTVT Sbjct: 111 SGKFLRRFRLPENAKMDQVKASMENGVLTVT 141 >ref|XP_002520483.1| heat-shock protein, putative [Ricinus communis] gi|223540325|gb|EEF41896.1| heat-shock protein, putative [Ricinus communis] Length = 157 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 351 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 259 SGKFLRRFR+PENAK+DQVKASMENGVLTVT Sbjct: 107 SGKFLRRFRMPENAKIDQVKASMENGVLTVT 137 >ref|XP_002520464.1| heat-shock protein, putative [Ricinus communis] gi|223540306|gb|EEF41877.1| heat-shock protein, putative [Ricinus communis] Length = 157 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 351 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 259 SGKFLRRFRLPENAK+DQVKASMENGVLTVT Sbjct: 109 SGKFLRRFRLPENAKMDQVKASMENGVLTVT 139 >ref|XP_007159139.1| hypothetical protein PHAVU_002G212000g [Phaseolus vulgaris] gi|561032554|gb|ESW31133.1| hypothetical protein PHAVU_002G212000g [Phaseolus vulgaris] Length = 145 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 351 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 259 SGKFLRRFRLPENAKV+QVKASMENGVLTVT Sbjct: 97 SGKFLRRFRLPENAKVEQVKASMENGVLTVT 127 >ref|XP_002520462.1| heat-shock protein, putative [Ricinus communis] gi|223540304|gb|EEF41875.1| heat-shock protein, putative [Ricinus communis] Length = 160 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 351 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 259 SGKFLRRFRLPENAK+DQ+KASMENGVLTVT Sbjct: 112 SGKFLRRFRLPENAKMDQIKASMENGVLTVT 142 >ref|XP_002312132.1| 18.2 kDa class I heat shock family protein [Populus trichocarpa] gi|222851952|gb|EEE89499.1| 18.2 kDa class I heat shock family protein [Populus trichocarpa] Length = 162 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 351 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 259 SGKFLRRFRLPENAK DQVKASMENGVLTVT Sbjct: 114 SGKFLRRFRLPENAKADQVKASMENGVLTVT 144 >gb|AHI18144.1| 17.6 kDa class 1 small heat shock protein [Solanum tuberosum] Length = 154 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 351 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 259 SGKF+RRFRLPENAK+DQVKASMENGVLTVT Sbjct: 106 SGKFMRRFRLPENAKMDQVKASMENGVLTVT 136 >ref|XP_006480920.1| PREDICTED: 17.7 kDa class I heat shock protein-like [Citrus sinensis] Length = 145 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 348 GKFLRRFRLPENAKVDQVKASMENGVLTVT 259 GKFLRRFRLPENAK+DQVKASMENGVLTVT Sbjct: 98 GKFLRRFRLPENAKIDQVKASMENGVLTVT 127 >ref|XP_006350804.1| PREDICTED: 17.7 kDa class I heat shock protein-like [Solanum tuberosum] Length = 154 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 351 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 259 SGKF+RRFRLPENAK+DQVKASMENGVLTVT Sbjct: 106 SGKFMRRFRLPENAKMDQVKASMENGVLTVT 136 >ref|XP_006350803.1| PREDICTED: 17.6 kDa class I heat shock protein-like [Solanum tuberosum] Length = 154 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 351 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 259 SGKF+RRFRLPENAK+DQVKASMENGVLTVT Sbjct: 106 SGKFMRRFRLPENAKMDQVKASMENGVLTVT 136 >ref|XP_006350800.1| PREDICTED: 17.8 kDa class I heat shock protein-like [Solanum tuberosum] Length = 154 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 351 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 259 SGKF+RRFRLPENAK+DQVKASMENGVLTVT Sbjct: 106 SGKFMRRFRLPENAKMDQVKASMENGVLTVT 136 >ref|XP_007159362.1| hypothetical protein PHAVU_002G231800g [Phaseolus vulgaris] gi|561032777|gb|ESW31356.1| hypothetical protein PHAVU_002G231800g [Phaseolus vulgaris] Length = 160 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 351 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 259 SG+F+RRFRLPENAKVDQVKASMENGVLTVT Sbjct: 112 SGRFMRRFRLPENAKVDQVKASMENGVLTVT 142 >ref|XP_007159358.1| hypothetical protein PHAVU_002G231400g [Phaseolus vulgaris] gi|561032773|gb|ESW31352.1| hypothetical protein PHAVU_002G231400g [Phaseolus vulgaris] Length = 160 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 351 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 259 SGKF+R+FRLPENAKVDQVKASMENGVLTVT Sbjct: 112 SGKFMRKFRLPENAKVDQVKASMENGVLTVT 142 >ref|XP_006429242.1| hypothetical protein CICLE_v10013046mg [Citrus clementina] gi|557531299|gb|ESR42482.1| hypothetical protein CICLE_v10013046mg [Citrus clementina] Length = 145 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 348 GKFLRRFRLPENAKVDQVKASMENGVLTVT 259 GKFLRRFRLPENAK+DQVKASMENGVLTVT Sbjct: 98 GKFLRRFRLPENAKIDQVKASMENGVLTVT 127 >ref|XP_004241201.1| PREDICTED: 17.7 kDa class I heat shock protein-like [Solanum lycopersicum] Length = 154 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 351 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 259 SGKF+RRFRLPENAK+DQVKASMENGVLTVT Sbjct: 106 SGKFMRRFRLPENAKMDQVKASMENGVLTVT 136 >ref|NP_001275610.1| 17.6 kDa class I heat shock protein-like [Solanum tuberosum] gi|413968516|gb|AFW90595.1| 17.6 kDa class I small heat shock protein 20.1 [Solanum tuberosum] gi|580960824|gb|AHI18143.1| 17.6 kDa class 1 small heat shock protein [Solanum tuberosum] Length = 154 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 351 SGKFLRRFRLPENAKVDQVKASMENGVLTVT 259 SGKF+RRFRLPENAK+DQVKASMENGVLTVT Sbjct: 106 SGKFMRRFRLPENAKMDQVKASMENGVLTVT 136