BLASTX nr result
ID: Sinomenium22_contig00001040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00001040 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006660046.1| PREDICTED: 60S ribosomal protein L7a-like, p... 81 1e-13 pdb|3J61|G Chain G, Localization Of The Large Subunit Ribosomal ... 81 2e-13 ref|XP_006661416.1| PREDICTED: 60S ribosomal protein L7a-like [O... 81 2e-13 ref|XP_004974014.1| PREDICTED: 60S ribosomal protein L7a-like [S... 81 2e-13 ref|XP_004965571.1| PREDICTED: 60S ribosomal protein L7a-like [S... 81 2e-13 ref|XP_004957297.1| PREDICTED: 60S ribosomal protein L7a-like [S... 81 2e-13 ref|XP_007038052.1| Ribosomal protein L7Ae/L30e/S12e/Gadd45 fami... 81 2e-13 gb|EMT16847.1| 60S ribosomal protein L7a [Aegilops tauschii] 81 2e-13 gb|EMS59723.1| 60S ribosomal protein L7a [Triticum urartu] 81 2e-13 ref|NP_001061550.1| Os08g0326400 [Oryza sativa Japonica Group] g... 81 2e-13 tpg|DAA48239.1| TPA: hypothetical protein ZEAMMB73_836459 [Zea m... 81 2e-13 ref|XP_003578397.1| PREDICTED: 60S ribosomal protein L7a-like [B... 81 2e-13 dbj|BAK06028.1| predicted protein [Hordeum vulgare subsp. vulgar... 81 2e-13 gb|ADE75607.1| unknown [Picea sitchensis] 81 2e-13 ref|XP_002462637.1| hypothetical protein SORBIDRAFT_02g029380 [S... 81 2e-13 gb|ACG47588.1| 60S ribosomal protein L7a [Zea mays] 81 2e-13 ref|NP_001148801.1| LOC100282418 [Zea mays] gi|195622244|gb|ACG3... 81 2e-13 gb|ACF84860.1| unknown [Zea mays] gi|414869683|tpg|DAA48240.1| T... 81 2e-13 ref|NP_001147139.1| 60S ribosomal protein L7a [Zea mays] gi|1946... 81 2e-13 ref|NP_001130097.1| uncharacterized protein LOC100191190 [Zea ma... 81 2e-13 >ref|XP_006660046.1| PREDICTED: 60S ribosomal protein L7a-like, partial [Oryza brachyantha] Length = 247 Score = 80.9 bits (198), Expect(2) = 1e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 11 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 46 Score = 20.8 bits (42), Expect(2) = 1e-13 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = -3 Query: 171 WPQKEVQSPLYQQR 130 W Q++V +PL+++R Sbjct: 4 WVQEKVTNPLFEKR 17 >pdb|3J61|G Chain G, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s Ribosome Length = 257 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 21 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 56 >ref|XP_006661416.1| PREDICTED: 60S ribosomal protein L7a-like [Oryza brachyantha] Length = 268 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 32 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 67 >ref|XP_004974014.1| PREDICTED: 60S ribosomal protein L7a-like [Setaria italica] Length = 257 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 21 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 56 >ref|XP_004965571.1| PREDICTED: 60S ribosomal protein L7a-like [Setaria italica] Length = 258 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 22 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 57 >ref|XP_004957297.1| PREDICTED: 60S ribosomal protein L7a-like [Setaria italica] Length = 257 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 21 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 56 >ref|XP_007038052.1| Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein [Theobroma cacao] gi|508775297|gb|EOY22553.1| Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein [Theobroma cacao] Length = 258 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 22 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 57 >gb|EMT16847.1| 60S ribosomal protein L7a [Aegilops tauschii] Length = 267 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 31 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 66 >gb|EMS59723.1| 60S ribosomal protein L7a [Triticum urartu] Length = 278 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 22 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 57 >ref|NP_001061550.1| Os08g0326400 [Oryza sativa Japonica Group] gi|115480049|ref|NP_001063618.1| Os09g0507800 [Oryza sativa Japonica Group] gi|548774|sp|P35685.1|RL7A_ORYSJ RecName: Full=60S ribosomal protein L7a gi|303855|dbj|BAA02156.1| ribosomal protein L7A [Oryza sativa Japonica Group] gi|38423963|dbj|BAD01672.1| 60S ribosomal protein L7A [Oryza sativa Japonica Group] gi|38637005|dbj|BAD03264.1| 60S ribosomal protein L7A [Oryza sativa Japonica Group] gi|113623519|dbj|BAF23464.1| Os08g0326400 [Oryza sativa Japonica Group] gi|113631851|dbj|BAF25532.1| Os09g0507800 [Oryza sativa Japonica Group] gi|125564310|gb|EAZ09690.1| hypothetical protein OsI_31973 [Oryza sativa Indica Group] gi|125606274|gb|EAZ45310.1| hypothetical protein OsJ_29953 [Oryza sativa Japonica Group] gi|215692651|dbj|BAG88071.1| unnamed protein product [Oryza sativa Japonica Group] gi|215692800|dbj|BAG88244.1| unnamed protein product [Oryza sativa Japonica Group] gi|215768136|dbj|BAH00365.1| unnamed protein product [Oryza sativa Japonica Group] gi|218200951|gb|EEC83378.1| hypothetical protein OsI_28791 [Oryza sativa Indica Group] Length = 258 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 22 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 57 >tpg|DAA48239.1| TPA: hypothetical protein ZEAMMB73_836459 [Zea mays] Length = 153 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 21 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 56 >ref|XP_003578397.1| PREDICTED: 60S ribosomal protein L7a-like [Brachypodium distachyon] gi|357166491|ref|XP_003580728.1| PREDICTED: 60S ribosomal protein L7a-like [Brachypodium distachyon] Length = 258 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 22 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 57 >dbj|BAK06028.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326528305|dbj|BAJ93334.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 259 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 23 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 58 >gb|ADE75607.1| unknown [Picea sitchensis] Length = 258 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 22 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 57 >ref|XP_002462637.1| hypothetical protein SORBIDRAFT_02g029380 [Sorghum bicolor] gi|242049790|ref|XP_002462639.1| hypothetical protein SORBIDRAFT_02g029400 [Sorghum bicolor] gi|241926014|gb|EER99158.1| hypothetical protein SORBIDRAFT_02g029380 [Sorghum bicolor] gi|241926016|gb|EER99160.1| hypothetical protein SORBIDRAFT_02g029400 [Sorghum bicolor] Length = 258 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 22 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 57 >gb|ACG47588.1| 60S ribosomal protein L7a [Zea mays] Length = 255 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 21 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 56 >ref|NP_001148801.1| LOC100282418 [Zea mays] gi|195622244|gb|ACG32952.1| 60S ribosomal protein L7a [Zea mays] gi|219887097|gb|ACL53923.1| unknown [Zea mays] gi|414886143|tpg|DAA62157.1| TPA: 60S ribosomal protein L7a [Zea mays] Length = 258 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 22 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 57 >gb|ACF84860.1| unknown [Zea mays] gi|414869683|tpg|DAA48240.1| TPA: hypothetical protein ZEAMMB73_836459 [Zea mays] Length = 185 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 21 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 56 >ref|NP_001147139.1| 60S ribosomal protein L7a [Zea mays] gi|194699752|gb|ACF83960.1| unknown [Zea mays] gi|195607614|gb|ACG25637.1| 60S ribosomal protein L7a [Zea mays] gi|414589924|tpg|DAA40495.1| TPA: 60S ribosomal protein L7a [Zea mays] Length = 258 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 22 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 57 >ref|NP_001130097.1| uncharacterized protein LOC100191190 [Zea mays] gi|194688280|gb|ACF78224.1| unknown [Zea mays] gi|194702256|gb|ACF85212.1| unknown [Zea mays] gi|414869684|tpg|DAA48241.1| TPA: 60S ribosomal protein L7a [Zea mays] Length = 257 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 109 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 2 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ Sbjct: 21 NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQ 56