BLASTX nr result
ID: Sinomenium22_contig00000813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00000813 (661 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004306686.1| PREDICTED: abscisic acid receptor PYL9-like ... 65 2e-08 ref|XP_007218488.1| hypothetical protein PRUPE_ppa012114mg [Prun... 65 2e-08 gb|EXB62204.1| hypothetical protein L484_017591 [Morus notabilis] 62 2e-07 ref|XP_007040497.1| Regulatory components of ABA receptor 3 [The... 62 2e-07 ref|XP_002270037.2| PREDICTED: abscisic acid receptor PYL8 [Viti... 62 2e-07 ref|XP_002513580.1| conserved hypothetical protein [Ricinus comm... 62 2e-07 ref|XP_002304553.1| hypothetical protein POPTR_0003s13900g [Popu... 62 2e-07 emb|CBI22536.3| unnamed protein product [Vitis vinifera] 62 2e-07 emb|CBI34472.3| unnamed protein product [Vitis vinifera] 62 2e-07 gb|EXB72449.1| hypothetical protein L484_011451 [Morus notabilis] 61 4e-07 ref|XP_006444870.1| hypothetical protein CICLE_v10022440mg [Citr... 61 4e-07 ref|XP_004234175.1| PREDICTED: abscisic acid receptor PYL8-like ... 61 4e-07 ref|XP_004234174.1| PREDICTED: abscisic acid receptor PYL8-like ... 61 4e-07 ref|XP_004145925.1| PREDICTED: abscisic acid receptor PYL8-like ... 61 4e-07 ref|XP_007135240.1| hypothetical protein PHAVU_010G112500g [Phas... 61 4e-07 gb|AAT35532.1| CAPIP1 [Capsicum annuum] 61 4e-07 gb|AEK99284.1| ABA receptor, partial [Cucumis sativus] 61 4e-07 gb|ABF72432.1| PIP1 [Capsicum annuum] 61 4e-07 ref|XP_007218467.1| hypothetical protein PRUPE_ppa011927mg [Prun... 60 5e-07 gb|ABK92491.1| unknown [Populus trichocarpa] 60 5e-07 >ref|XP_004306686.1| PREDICTED: abscisic acid receptor PYL9-like [Fragaria vesca subsp. vesca] Length = 184 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPIRH 117 NTKD+T YFVE +IRCNLKSL+DVSER+ +QDR+ PI H Sbjct: 146 NTKDETCYFVEALIRCNLKSLADVSERMAVQDRTEPINH 184 >ref|XP_007218488.1| hypothetical protein PRUPE_ppa012114mg [Prunus persica] gi|462414950|gb|EMJ19687.1| hypothetical protein PRUPE_ppa012114mg [Prunus persica] Length = 183 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPIRH 117 NTKD+T YFVE +IRCNLKSL+DVSER+ +QDR+ PI H Sbjct: 145 NTKDETCYFVEALIRCNLKSLADVSERMAVQDRTEPINH 183 >gb|EXB62204.1| hypothetical protein L484_017591 [Morus notabilis] Length = 202 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPI 111 NTKD+T YFVE +IRCNLKSL+DVSER+ +QDR+ PI Sbjct: 164 NTKDETCYFVEALIRCNLKSLADVSERMAVQDRTEPI 200 >ref|XP_007040497.1| Regulatory components of ABA receptor 3 [Theobroma cacao] gi|508777742|gb|EOY24998.1| Regulatory components of ABA receptor 3 [Theobroma cacao] Length = 193 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPI 111 NTKD+T YFVE +I+CNLKSL+DVSERL +QDR+ PI Sbjct: 154 NTKDETCYFVEALIKCNLKSLADVSERLAVQDRTEPI 190 >ref|XP_002270037.2| PREDICTED: abscisic acid receptor PYL8 [Vitis vinifera] Length = 83 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPI 111 NTKD+T YFVE +I+CNLKSL+DVSERL +QDR+ PI Sbjct: 44 NTKDETCYFVEALIKCNLKSLADVSERLAVQDRTEPI 80 >ref|XP_002513580.1| conserved hypothetical protein [Ricinus communis] gi|223547488|gb|EEF48983.1| conserved hypothetical protein [Ricinus communis] Length = 195 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPI 111 NTKD+T YFVE +I+CNLKSL+DVSERL +QDR+ PI Sbjct: 156 NTKDETCYFVEALIKCNLKSLADVSERLAVQDRTEPI 192 >ref|XP_002304553.1| hypothetical protein POPTR_0003s13900g [Populus trichocarpa] gi|222841985|gb|EEE79532.1| hypothetical protein POPTR_0003s13900g [Populus trichocarpa] Length = 190 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPI 111 NTKD+T YFVE +I+CNLKSL+DVSERL +QDR+ PI Sbjct: 151 NTKDETCYFVEALIKCNLKSLADVSERLAVQDRTEPI 187 >emb|CBI22536.3| unnamed protein product [Vitis vinifera] Length = 185 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPI 111 NTKD+T YFVE +I+CNLKSL+DVSERL +QDR+ PI Sbjct: 146 NTKDETCYFVEALIKCNLKSLADVSERLAVQDRTEPI 182 >emb|CBI34472.3| unnamed protein product [Vitis vinifera] Length = 185 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPI 111 NTKD+T YFVE +I+CNLKSL+DVSERL +QDR+ PI Sbjct: 146 NTKDETCYFVEALIKCNLKSLADVSERLAIQDRTEPI 182 >gb|EXB72449.1| hypothetical protein L484_011451 [Morus notabilis] Length = 194 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPI 111 NTKDDT YFVE +I+CNLKSL+DVSER +QDR+ PI Sbjct: 155 NTKDDTCYFVEALIKCNLKSLADVSERRAVQDRTEPI 191 >ref|XP_006444870.1| hypothetical protein CICLE_v10022440mg [Citrus clementina] gi|568876373|ref|XP_006491255.1| PREDICTED: abscisic acid receptor PYL9-like [Citrus sinensis] gi|557547132|gb|ESR58110.1| hypothetical protein CICLE_v10022440mg [Citrus clementina] Length = 186 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPI 111 NTKD+T YFV+ +IRCNLKSL+DVSER+ +QDR+ PI Sbjct: 147 NTKDETCYFVQALIRCNLKSLADVSERMAVQDRTEPI 183 >ref|XP_004234175.1| PREDICTED: abscisic acid receptor PYL8-like isoform 2 [Solanum lycopersicum] Length = 185 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPI 111 NTKD+T YFVE +I CNLKSL+DVSERL +QDR+ PI Sbjct: 146 NTKDETCYFVEALINCNLKSLADVSERLAVQDRTEPI 182 >ref|XP_004234174.1| PREDICTED: abscisic acid receptor PYL8-like isoform 1 [Solanum lycopersicum] Length = 207 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPI 111 NTKD+T YFVE +I CNLKSL+DVSERL +QDR+ PI Sbjct: 168 NTKDETCYFVEALINCNLKSLADVSERLAVQDRTEPI 204 >ref|XP_004145925.1| PREDICTED: abscisic acid receptor PYL8-like [Cucumis sativus] gi|449524854|ref|XP_004169436.1| PREDICTED: abscisic acid receptor PYL8-like [Cucumis sativus] Length = 195 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPI 111 NTKD+T YFVE +I+CNLKSL+DVSERL +QDR+ P+ Sbjct: 156 NTKDETCYFVEALIKCNLKSLADVSERLAVQDRTEPL 192 >ref|XP_007135240.1| hypothetical protein PHAVU_010G112500g [Phaseolus vulgaris] gi|413968352|gb|AFW90514.1| pathogenesis-induced protein [Phaseolus vulgaris] gi|561008285|gb|ESW07234.1| hypothetical protein PHAVU_010G112500g [Phaseolus vulgaris] Length = 185 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPIRH 117 NTKD+T YFVE +IRCNL SL+DVSER+ +Q R++PI H Sbjct: 147 NTKDETCYFVEALIRCNLSSLADVSERMAVQGRTDPINH 185 >gb|AAT35532.1| CAPIP1 [Capsicum annuum] Length = 186 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPI 111 NTKD+T YFVE +I CNLKSL+DVSERL +QDR+ PI Sbjct: 147 NTKDETCYFVEALINCNLKSLADVSERLAVQDRTEPI 183 >gb|AEK99284.1| ABA receptor, partial [Cucumis sativus] Length = 107 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPI 111 NTKD+T YFVE +I+CNLKSL+DVSERL +QDR+ P+ Sbjct: 68 NTKDETCYFVEALIKCNLKSLADVSERLAVQDRTEPL 104 >gb|ABF72432.1| PIP1 [Capsicum annuum] Length = 185 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPI 111 NTKD+T YFVE +I CNLKSL+DVSERL +QDR+ PI Sbjct: 146 NTKDETCYFVEALINCNLKSLADVSERLAVQDRTEPI 182 >ref|XP_007218467.1| hypothetical protein PRUPE_ppa011927mg [Prunus persica] gi|462414929|gb|EMJ19666.1| hypothetical protein PRUPE_ppa011927mg [Prunus persica] Length = 191 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPI 111 NTKD+T YFVE +I+CNLKSL DVSERL +QDR+ PI Sbjct: 152 NTKDETCYFVEALIQCNLKSLCDVSERLAVQDRTEPI 188 >gb|ABK92491.1| unknown [Populus trichocarpa] Length = 186 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +1 Query: 1 NTKDDTIYFVETMIRCNLKSLSDVSERLTMQDRSNPI 111 NTKD+T YFVE +IRCNLKSL+DVSER+ +QDR P+ Sbjct: 147 NTKDETCYFVEALIRCNLKSLADVSERMAVQDRVEPV 183