BLASTX nr result
ID: Sinomenium22_contig00000793
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00000793 (608 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004165590.1| PREDICTED: translation machinery-associated ... 58 2e-06 gb|EXB74494.1| hypothetical protein L484_026188 [Morus notabilis... 58 2e-06 ref|XP_004133991.1| PREDICTED: translation machinery-associated ... 57 5e-06 >ref|XP_004165590.1| PREDICTED: translation machinery-associated protein 7-like [Cucumis sativus] Length = 109 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 573 SD*RIMSSRQGGKAKPLKQPKAKEKDYDEVDLENMQ 466 SD MSS+QGGKAKPLKQPK +KDYDEVD+ NMQ Sbjct: 41 SDISAMSSKQGGKAKPLKQPKVDKKDYDEVDMANMQ 76 >gb|EXB74494.1| hypothetical protein L484_026188 [Morus notabilis] gi|587939319|gb|EXC25980.1| hypothetical protein L484_000574 [Morus notabilis] Length = 64 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 558 MSSRQGGKAKPLKQPKAKEKDYDEVDLENMQ 466 MSS+QGGKAKPLKQPKA +KDYDEVDL N+Q Sbjct: 1 MSSKQGGKAKPLKQPKADKKDYDEVDLANLQ 31 >ref|XP_004133991.1| PREDICTED: translation machinery-associated protein 7-like isoform 1 [Cucumis sativus] gi|449432410|ref|XP_004133992.1| PREDICTED: translation machinery-associated protein 7-like isoform 2 [Cucumis sativus] Length = 64 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 558 MSSRQGGKAKPLKQPKAKEKDYDEVDLENMQ 466 MSS+QGGKAKPLKQPK +KDYDEVD+ NMQ Sbjct: 1 MSSKQGGKAKPLKQPKVDKKDYDEVDMANMQ 31