BLASTX nr result
ID: Sinomenium22_contig00000783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00000783 (2941 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB00038.1| reverse transcriptase family member [Glycine max] 59 3e-07 ref|NP_001183823.1| uncharacterized protein LOC100502416 [Zea ma... 55 6e-06 emb|CCH50976.1| T4.15 [Malus x robusta] 52 8e-06 >gb|ABB00038.1| reverse transcriptase family member [Glycine max] Length = 377 Score = 58.5 bits (140), Expect(2) = 3e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +3 Query: 2829 VTEMRMLRWICGKTLKDKIRNEHI*EMVGVAPIGDKM 2939 V EMRMLRW+CGKT +DKIRNE I E VGVAPI +KM Sbjct: 265 VAEMRMLRWMCGKTRQDKIRNEAIRERVGVAPIVEKM 301 Score = 25.8 bits (55), Expect(2) = 3e-07 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 2743 GKFYKTNIMPIMLNETKCLA 2802 GKFY+T + P +L T+C A Sbjct: 235 GKFYRTAVRPTILYGTECWA 254 >ref|NP_001183823.1| uncharacterized protein LOC100502416 [Zea mays] gi|238014750|gb|ACR38410.1| unknown [Zea mays] Length = 215 Score = 54.7 bits (130), Expect(2) = 6e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +3 Query: 2829 VTEMRMLRWICGKTLKDKIRNEHI*EMVGVAPIGDKM 2939 V EMRMLRWICG T +D++RN+ I E VGVAPI +K+ Sbjct: 104 VAEMRMLRWICGHTRRDRVRNDDIRERVGVAPIEEKL 140 Score = 25.0 bits (53), Expect(2) = 6e-06 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 2743 GKFYKTNIMPIMLNETKC 2796 GKFY+T I P ML +C Sbjct: 74 GKFYRTAIRPAMLYGAEC 91 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 51.6 bits (122), Expect(2) = 8e-06 Identities = 26/37 (70%), Positives = 27/37 (72%) Frame = +3 Query: 2829 VTEMRMLRWICGKTLKDKIRNEHI*EMVGVAPIGDKM 2939 V EMRMLRW+CG T KDKIRNE I VGVA I KM Sbjct: 873 VAEMRMLRWMCGHTRKDKIRNEDIRGKVGVAEIQGKM 909 Score = 27.7 bits (60), Expect(2) = 8e-06 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 2743 GKFYKTNIMPIMLNETKCLA 2802 GKFY+T I P ML T+C A Sbjct: 843 GKFYRTAIRPAMLYGTECWA 862