BLASTX nr result
ID: Sinomenium22_contig00000408
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00000408 (487 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006843609.1| hypothetical protein AMTR_s00007p00143190 [A... 58 2e-06 >ref|XP_006843609.1| hypothetical protein AMTR_s00007p00143190 [Amborella trichopoda] gi|548845977|gb|ERN05284.1| hypothetical protein AMTR_s00007p00143190 [Amborella trichopoda] Length = 471 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/53 (47%), Positives = 34/53 (64%) Frame = -3 Query: 176 QNRDMPPPMANQGFQNTNMPPPTQNWNYQSRQMPPPTQNQDFQNRGIPPPPQN 18 QN++ PP Q +QN +MP T + YQ+R MPP +Q FQNR IPP P++ Sbjct: 255 QNKETPPMPNTQDYQNRDMPQMTNSQGYQNRDMPPMPNSQGFQNRDIPPMPRD 307